Как проверить сайт компании: Три полезные ссылки. Как проверить веб-сайт компании перед покупкой

Содержание

Три полезные ссылки. Как проверить веб-сайт компании перед покупкой

Этот инструмент дает хороший общий обзор по посещаемости сайта, именно с него стоит начать проверку. Разобраться во всех функциях тут несложно, в целом — они видны на скриншоте. Так как SimilarWeb, пожалуй, самый известный инструмент из всех, не будем на нем подробно останавливаться.

Дает более детальную информацию по трафику. А все мы знаем, что трафик  — показатель популярности и раскрученности сайта.

Кстати, с его же помощью можно сделать отличный анализ конкурентов по ключевым словам поиска, понять их сильные и слабые стороны, определить, где можно самому усовершенствовать сайт. Сервис подойдет для локального и глобального анализа.

Здесь же можно проанализировать эффективность маркетинговых кампаний, контент-маркетинг и сделать общий поиск конкурентов для анализа в определенной нише. Кроме того, Serpstat дает рекомендации по маркетинг интелидженс. Работает на отлично. Есть бесплатная версия.


Это веб-сервис для владельцев сайтов, веб-мастеров и просто интернет-пользователей. Тут можно получить информацию, связанную с доменными именами, IP-адресами, веб-серверами и поисковой оптимизацией (SEO).

Инструмент предоставляет статистические отчеты для разных веб-сайтов, например, оценки сайта, отчеты Search Engine, отчеты о трафике, социальной активности, безопасности, информацию о хосте, WHOIS-домене, Page Speed (скорость загрузки) и многое другое. Для получения полных отчетов нужно просто ввести имя домена.

Кстати, сервис покажет и сайты, подобные по рейтингу и содержанию — это может помочь в оценке конкурентоспособности на рынке, покажет линкование сайта.


Перед покупкой сайта рекомендуем делать комплексный анализ по этому списку факторов:

  • Возраст сайта.
  • Премиум инструменты / плагины, используемые для запуска веб-сайта.
  • Ежемесячный доход.
  • Page Rank и Alexa Rank сайта.
  • Количество обратных ссылок.
  • Количество качественных обратных ссылок.
  • Количество опубликованных сообщений.
  • Правильная грамматика и качество статей сайта.
  • Оригинальность опубликованных статей.
  • Проверенные аналитики.
  • Число посетителей в месяц / в день.

А вот еще список ресурсов для проверки сайтов:

  1. YourWebsiteValue.com
  2. WorthOfWeb.com
  3. WebsiteOutlook.com
  4. FreeSiteWorth.com
  5. SiteValueCheck.com
  6. Glurk.com
  7. SitePrice.com
  8. CuteStat.com
  9. MyWebsiteWorth.com
  10. SiteValueCalculator.com
  11. StatMyWeb.com
  12. Webuka.com


Фото на обложке: Pixabay

Материалы по теме:

Три полезные ссылки. Как сделать сайт из страницы в Facebook

7 полезных инструментов, чтобы проверить, нужно ли вам выходить за рубеж

Чек-лист: что проверить перед покупкой франшизы

Как инвестору самостоятельно проверить стартап

Как определить, безопасен ли сайт?

Сомневаетесь в подлинности интернет-магазина, который обещает большие скидки, или ваш онлайн-банк работает как-то не так? Мы составили инструкцию, как определить подлинность сайта и не стать жертвой фишинга.

Давно прошли времена, когда серфить в сети было сплошным удовольствием. Сегодня интернет чаще похож на минное поле, чем на игровую площадку. Сложно использовать все преимущества цифрового мира, когда тревога и подозрительность становятся настолько распространенными.

Чтобы обманом вынудить пользователя загрузить вредоносную программу или раскрыть конфиденциальные данные, все чаще используются социальная инженерия и фишинг. Один из самых популярных методов — создание поддельного сайта, чтобы обманным путем заставить пользователя ввести свои учетные данные для входа или сведения об учетной записи. Чаще речь идет о поддельных интернет-магазинах или фейковых страницах онлайн-банка, потому что это легко монетизируется, ведь вбив данные ваши карты на таком сайте, они попадают в руки злоумышленников.

Социальную инженерию также могут использовать, чтобы заманить пользователя на зараженный сайт, при переходе на который в систему загрузится вредоносная программа. Кроме того, пользователю могут направить по вредоносной ссылке, которая даст киберпреступникам возможность на получение разрешения на удаленный доступ и управление устройством. Никто не хочет стать жертвой такого мошенничества.

Хорошая новость состоит в том, существуют способы защитить себя. Мы сформулировали три блока, которые помогут определить безопасность сайтов, помогут разобраться в этой теме и научиться отличать надежные сайты от вредоносных. От простых визуальных проверок до специальных сервисов проверки безопасности сайтов.

1. Визуальная проверка безопасности сайта

Дважды проверяйте URL-адреса

Начнем с самого простого совета. Теперь проверить достоверность URL-адреса совсем не сложно. Первая уловка организаторов

фишинговых атак — сделать адрес как можно более похожим на оригинальный (мало кто с первого раза может заметить небольшую небольшую ошибку в адресе). На первый взгляд URL-адрес может выглядеть как подлинный, но более тщательная проверка может показать, что он содержит цифру 1 вместо буквы l или домен .ru заменили на .com.

Проверка наличия протокола https

Буквы http, которые мы можем увидеть в начале адреса обозначают протокол передачи данных, при котором их намного легче перехватить, чем при защищенном https.

Действительно,“S” в аббревиатуре https означает “secure”, то есть «защищенный». Иными словами, если веб-сайт работает с протоколом https, то канал передачи данных между браузером и сервером, на котором размещается веб-сайт, надежно зашифрован. Если, вы не уверены, что сайт или ссылка защищены протоколом

https, будьте внимательны и не вводите никакие персональные данные.

Однако защищенное подключение по себе еще не является гарантией того, что перед вами благонадежный интернет-ресурс, а не мошеннический сайт, владелец которого только и ждет того, что вы оставите на нем свои персональные данные.

Киберпреступники делают все возможное, чтобы выдать свои сайты за подлинные, и хотя сайты https являются более безопасными, они все равно могут принадлежать мошенникам за счет использования поддельных сертификатов.

2. Средства проверки безопасности сайтов

Используйте встроенные в браузер средства

В первую очередь, следует использовать возможности браузера. Проверьте настройки конфиденциальности и безопасности. Скорее всего, настройки по умолчанию покажутся вам недостаточно надежными. Вручную измените правила и настройки согласно своим требованиям. Заблокируйте всплывающие уведомления, отключите автоматическую загрузку и не давайте согласие на отслеживание. Возможности настройки зависят от браузера.

Выполните онлайн-проверку безопасности сайта

Существует несколько сервисов проверки безопасности сайтов, таких как VirusTotal. Такого рода онлайн-инструменты используют данные различных антивирусных решений и другие средства защиты для проверки сайтов на наличие угроз. Необходимо просто ввести URL-адрес сайта, который нужно проверить, в поисковую строку на сайте, и вы сразу же получите результаты.

Введите URL-адрес и VirusTotal сообщит вам является ли он вредоносным

Установите дополнительные программы для защиты в сети

Чтобы полностью обезопасить себя в интернете, следует использовать проверенные решения для защиты от киберугроз, например, Avast Free Antivirus. Новый Avast 2019 обладает обновленной технологией антифишинга, которая защитит вас от поддельных страниц. Благодаря машинному обучению и технологиям визуального анализа, мы стали быстрее распознавать фишинговые сайты и оповещать об этом.

Дополнительную безопасность и анонимность в сети можно обеспечить за счет технологии VPN. Также вы можете воспользоваться бесплатным браузером Avast Secure Browser, который обеспечивает вашу защиту во время работы в сети.

3. Чеклист по проверке безопасности сайта

Проверьте раздел контактов на сайте

Если, выполнив все указанные действия, вы по-прежнему сомневаетесь в безопасности сайта, найдите раздел контактов и, если таковой имеется, свяжитесь с его владельцами и проверьте в поисковике их адрес электронной почты на предмет наличия отзывов.

Убедитесь, что ваш антивирус имеет сертификат защиты от фишинга

Они есть не у всех. Найдите результаты исследований независимых лабораторий, которые занимаются проверкой защиты от фишинга, например, в лабораторию AV-Comparatives. Они оценивают качество защиты антивирусных решений от фишинговых URL-адресов и проверяют наличие ложных срабатываний при распознавании настоящих банковских сайтов, чтобы убедиться, что продукт отличает безопасные сайты от поддельных. Avast Free Antivirus прошел эту проверку и стал единственным бесплатным программным обеспечением, получившим сертификат защиты от фишинга.

Проверьте наличие политики конфиденциальности на сайте

Это совсем не сложно. Если на сайте нет политики конфиденциальности — это повод усомниться в подлинности компании.

Проверьте, кому принадлежит сайт, с помощью службы WHOIS

Можно также узнать владельца конкретного домена, проверив общедоступные данные с помощью поиска по базе WHOIS. Узнайте все о домене, включая дату его регистрации и имя зарегистрировавшего его.

Будьте внимательнее при посещении веб-сайтов, а в случае наличия подозрений, не вбивайте свои данные в погоне за обещанной выгодой. Подвергайте дополнительной проверке неизвестные вам сайты, которые хотят получить ваши банковские и персональные данные.

Следите за нашими новостями в социальных сетях ВКонтакте, Одноклассники, Facebook и Twitter. 

Как проверить сайт на надежность, как найти обман на сайте?

Часто бывает, что вы заходите на сайт где пытаются продать какую-то услугу или товар и вам необходимо понять насколько вообще это реальный сайт, как давно он работает, не мошенники ли это. Давайте расскажу, что я делаю в таких случаях. Надеюсь, что эти советы будут полезны для вас.

Сколько сайту лет?

Первый шаг, который необходимо сделать – это вбить в Яндексе «whois». Это сервис, который есть на многих сайтах, через который можно проверить как давно вообще существует сайт, когда он был создан, насколько он проплачен.

Так вы сможете понять, может быть этот сайт существует меньше года, а в рекламных текстах у себя он заявляет, что 15 лет их компания чем-то занимается.

Также до какого периода проплачен – дает понять, что если допустим сайт проплачен на ближайшие полгода, то он не собирается развиваться в дальнейшем и скорее всего это некая такая временная прокладка, которая создана лишь для обмана. Вполне может быть, что все совсем не так, но это просто один из признаков, который вы должны взять во внимание.

Фотографии

Второй признак, который может навести вас на размышления – это фотографии. В частности фотографии в отзывах. То есть на сайте может быть очень много отзывов, и там прикреплены счастливые довольные люди, которые пользовались этими услугами.

Для проверки вы:

  • Правой кнопкой жмете на фотографии
  • Переходите в Яндекс картинки
  • Там сверху справа будет надпись «поиск по картинкам»
  • Жмете на неё, вставляете адрес этой картинки (либо вы её можете сохранить на компьютер и потом добавить, загрузить в этот сервис)
  • После этого вам покажется, где эта картинка встречается ещё. По выдаче будет довольно понятно, если у этой картинки миллион копий, она встречается на всех сайтах, может быть она есть на Shutterstock и на других биржах изображений.

Это явный признак того, что-либо они не очень хотели заморачиваться с поиском нормальных картинок, либо вероятно – признак некого мошенничества, сайта, сделанного на скорую руку.

Что ещё можно посмотреть и проверить?

На самом деле самый простой вариант – всегда вбивайте в поиск номер телефона, который указан. Это может быть номер, который обнаружится и на других сайтах. Также вбивайте этот номер со словом отзывы, вбивайте адрес домена со словом отзывы, название компании со словом отзывы и т.д.

Просто вбивая номер телефона без слова отзывы вы можете найти и другие сайты, например, прежнее название этой компании, и по ней уже со словом отзывы проверить не мошенники ли они.

Я думаю, что существует ещё много различных способов, это просто те базовые моментам, которыми необходимо пользоваться всегда, в любом случае при проверке любого подрядчика, контрагента и т.д. Ими пользуюсь я и советую вам.

Проверка сайта на мошенничество — инструкция и сервисы для анализа

За 2020 год Google обнаружил более 2 миллионов мошеннических сайтов. Люди не проверяют ресурсы, на которые заходят, а также с легкостью ведутся на манипуляции в сети. В этой статье мы рассмотрим способы, как определить сайт мошенника не только с помощью самостоятельного анализа, но и со специализированными сервисами.

Чем могут быть опасны сайты мошенников

Популярный способ мошенничества — это телефонные звонки, когда мошенник представляется сотрудником банка и просит жертву продиктовать пароль или код из SMS.

Но существуют и другие методы перехватить данные пользователя:

  • Обещание крупного заработка.
  • Убеждение, что деньги срочно нужно перевести на другой счет, чтобы защитить данные.
  • Просьба установить ПО для защиты данных либо, чтобы открыть сторонний файл.
  • В периоды обострения ситуации с пандемией коронавируса мошенники активно предлагали пользователям пройти медицинское обследование или получить компенсацию за ущерб от COVID-19.
  • Сообщение пожилым людям о том, что им полагаются выплаты и для их получения те должны сообщить банковские реквизиты.
  • Рассылка друзьям со взломанного аккаунта с просьбой занять денег или помочь в трудной ситуации.
  • Перенаправление пользователей на сторонний ресурс — якобы в связи с тем, что на официальном сайте ведутся технические работы.
  • Закрытые форумы, на которых человек может найти ответ — но только после прохождения процедуры регистрации.
  • Переход на поддельные сайты, которые полностью копируют популярные интернет-магазины или лендинги брендов, на которых компания якобы проводит розыгрыш.

Главная опасность заключается в том, что мошенники пытаются получить ваши личные данные и использовать их в корыстных целях. Этот процесс называется фишинг, что в переводе с английского языка означает «рыбалка» или «рыбная ловля».

Сайты мошенников ловят невнимательных пользователей, которые добровольно делятся конфиденциальной информацией: телефон, электронная почта, данные банковской карты, логины и пароли от личных кабинетов на других ресурсах.

Вы можете попасть на фишинговый сайт через ссылку в объявлении, рассылке или на поиске, где есть форма для заполнения данных или вирус, который сразу же активируется на вашем ПК или смартфоне.

Проверка сайта на подлинность

В этом разделе обсудим детали, на которые нужно обратить внимание, чтобы распознать мошеннический сайт.

Доменное имя

Часто мошенники регистрируют домены, URL которых похож на адреса сайтов официальных брендов — но содержит не слишком заметные опечатки или ошибки:

  • Буквы заменены символами — «sendpu1se.com»
  • Лишняя буква в названии— «sendpullse.com»
  • Подмена алфавита, который выглядит, как латинские буквы.

SSL-сертификат

Проверьте безопасность ресурса. В адресной строке браузера рядом с URL сайта вы найдете символ в виде «замочка». Если он закрыт — сайт безопасен, если нет — проверяйте другие детали, потому что даже проверенные ресурсы иногда забывают купить или продлить SSL-сертификат.

Пример, как выглядит «Безопасное подключение»

Вы можете нажать на раздел «Сертификат», который указан на скриншоте выше, и проверить срок его действия, а также увидеть, кому и кем было выдано разрешение.

В сертификате вы можете обратить внимание на его тип:

  • Domain Validation — базовый уровень сертификата, который подтверждает только доменное имя. Символ «замочка» имеет серый или белый цвет.
  • Вариант, как посмотреть тип сертификата
  • Organization Validation — сертификат, который подтверждает существование домена и организации. Его могут получить только компании. Символ «замочка» в адресной строке имеет серый или белый цвет.
  • Extended Validation — эффективное и дорогое решение, которое сложно получить, так как центр сертификации проверяет всю деятельность организации и запрашивает официальные документы. Символ «замочка» имеет зеленый цвет.

Внешний вид сайта

Посмотрите на сайт и ответьте на эти вопросы:

  • Текст на сайте отвечает всем стандартам русского языка и нет ошибок?
  • Все страницы сайта заполнены?
  • Правильно заполнены карточки товаров?
  • Кликабельна шапка сайта — логотип, номер телефона?
  • Правильно указано официальное название компании?
  • Есть реквизиты организации в подвале сайта или на его страницах: телефон, фирменное название, ИНН, юридический адрес и так далее?

Если вы ответили на эти вопросы «Нет» — скорее всего, попали на фишинговый сайт.

Пользовательские соглашения

Проверьте на сайте наличие пользовательского соглашения, условий доставки, гарантии и указана ли «Политика конфиденциальности данных». Найдите не только упоминание этих документов, но и сам текст.

Пример расположения документов

В пользовательском соглашении не должны быть упомянуты сторонние компании и другие реквизиты, отличающиеся от тех, что указаны на сайте.

Не нашли корректных документов пользовательского соглашения — закрывайте сайт.

Возраст сайта

Посмотрите футер сайта и найдите дату создания — возраст ресурса. Если портал создан недавно, закройте страницу.

Пример, как компания указывает возраст сайта

Отзывы

Изучите отзывы о домене. Если компания официальная, отзывы должны быть в карточках организаций на «Яндекс» и в Google, а также в специализированных сервисах — например, «Отзовик». В другом случае вы найдете сайты, на которых пользователи жалуются, что попали на фишинговый ресурс.

И самое важное, если вы заподозрили сайт в мошенничестве — ни в коем случае не заполняйте формы обратной связи и не переходите по ссылкам, с которыми вам предлагают ознакомиться. Форма может перекинуть вас, например, на QIWI Кошелек, в котором не будет возможности отследить передачу денег. На официальных ресурсах при этом всегда предусмотрено несколько способов для оплаты товара.

Бесплатная CRM для маркетинга и продаж

Принимайте заказы, контролируйте ход сделок с покупателями, собирайте базу контактов и запускайте маркетинговые кампании с помощью одного инструмента.

Попробовать бесплатно

Сервисы для проверки сайта на мошенничество

Сайт на мошенничество можно проверить через специализированные сервисы — о них и пойдет речь ниже.

Проверка через «Яндекс» и Google

Используйте бесплатные онлайн-инструменты от «Яндекс» и Google для проверки статуса сайта. Достаточно ввести URL ресурса, начать проверку и изучить результат поиска.

Ниже показан скриншот инструмента от Google:

Проверка сайта инструментом от Google

А это вариант проверки от «Яндекс»:

Проверка сайта инструментом от «Яндекса»

Плюсы:

  • Быстрая проверка.
  • Бесплатный сервис.

Минусы:

  • Если сайт создан буквально на днях — скорее всего, эти инструменты еще не успели его проанализировать и оценить статус безопасности.

WOT

Web of Trust — бесплатный сервис для быстрой проверки сайтов. Чтобы он смог проанализировать сайт, вводите URL без знака «слэш» и «https://».

Страница проверки сайта

Плюсы:

  • Позволяет проверить IP-адрес.
  • Есть расширение для Google Chrome. Предоставляет отчет по каждому порталу. А если на сайте есть следы фишинга или запрещенного контента – доступ к ресурсу будет моментально заблокирован.
  • Регулярно обновляются алгоритмы для поиска вредоносных сайтов.

Минусы:

  • Не обнаружено.

WebMoney Advisor

WebMoney Advisor — сервис, который показывает рейтинг сайта и отзывы. Изначально создавался для проверки транзакций.

Инструмент Advisor на сайте WebMoney

Плюсы:

  • Есть расширение для Google Chrome, которое показывает отзывы пользователей и рейтинг сайта.
  • Можно посмотреть топ-500 сайтов по репутации.
  • Показывает, есть ли на сайте возможность транзакций в системе WebMoney.

Минусы:

  • Сайты, которые не проводят финансовые операции, находятся вне оценочного рейтинга.
  • На репутацию можно влиять — присылать свои отзывы и ставить оценки с разных IP.

WhoIS

WhoIS — бесплатный сервис, который проверяет информацию о домене. Если вы хотите получать более точные и расширенные данные о сайтах — можете оформить подписку за 99 долларов в месяц.

Главная страница сервиса WhoIS

Это результат проверки сайта: кто зарегистрировал, когда и с помощью какого провайдера. А ниже — оценка качества сайта и информация по IP.

Результат проверки в WhoISПлюсы:
  • Быстрый и удобный сервис.
  • Широкая база доменных имен.
  • Позволяет отследить регистрационные данные мошенников.

Минусы:

  • Может показывать устаревшую информацию.
  • Нет данных по безопасности сайта.

VirusTotal

VirusTotal — бесплатный сервис, который проверяет не только ссылки, но и файлы на наличие вирусов.

Главная страница VirusTotal

Результат анализа сайта:

Пример проверки сайта в сервисе VirusTotal

Плюсы:

  • Сканирует ссылки и файлы.
  • Быстрая проверка.
  • Большая база антивирусных движков.
  • Показывает детали сайта — IP-адрес, качество ресурса, метатеги, трекеры и ссылки на странице.

Минусы:

  • Отсутствует мультиплатформенность.

Dr.Web online

Dr.Web online — сервис от антивируса для проверки вредоносных ссылок и мошеннических сайтов.

Инструмент для проверки вредоносного или мошеннического сайта

Плюсы:

Минусы:

  • Пользователь получает небольшой объем информации — сайт либо опасен, либо нет. Другие данные посмотреть нельзя.

Kaspersky VirusDesk

Kaspersky VirusDesk — инструмент, который собрал в себе возможности WhoIS. Может проверять сайты, ссылки, файлы и IP — способен предоставить информацию о регистрационных данных, но нет возможности проверить сайт на безопасность.

Чтобы получить полный доступ к информации — нужно заполнить анкету и запросить исследование. Стоимость вам озвучит специалист после проверки ваших данных.

Пример работы инструмента от Kaspersky

Плюсы:

  • Проверяет сайты по репутационной базе.
  • Показывает информацию о доменном имени.
  • Есть возможность узнать регистрационные данные.

Минусы:

  • Нет опции проверить сайт на безопасность.

Заключение

В этой статье мы рассмотрели понятие «фишинговые сайты» и определили ключевые детали, по которым можно распознать вредоносный портал. А также разобрали варианты специализированных сервисов, которые помогают понять, принадлежит ли он злоумышленникам.

Рекомендации, которые защитят вас от мошенников:

  • Установите антивирус — подобных программах сейчас есть встроенный инструмент для проверки фишинга.
  • Оформите виртуальную карту для онлайн-покупок, чтобы нигде не показывать свои личные данные.
  • Подключите двухфакторную аутентификацию, чтобы в случае взлома можно было быстро вернуть доступ к данным.
  • Используйте безопасные браузеры, которые поддерживают антифишинговую защиту, например, Google Chrome или Safari.
  • Если вы не уверены в безопасности сайта, проверьте его через онлайн-сервисы — до того, как выполнять какие-либо действия на его страницах.

Чтобы самому создать качественный одностраничный сайт, воспользуйтесь нашим конструктором для создания лендингов. К нему вы сможете подключить CRM, email, Viber и SMS рассылки, а также чат-боты в таких мессенджерах, как ВКонтакте, Facebook Messenger, Telegram и WhatsApp!

[Всего: 6   Средний:  4.3/5]

Как отличить официальный сайт от мошенников: советы от REG.RU

В преддверии праздничных праздничных распродаж вместе со всей ecommerce-отраслью активизируются мошенники. Они регистрируют сотни фишинговых доменов, имитирующих магазины популярных брендов. Как же понять какой ресурс безопасен, а на каком могут оставить вас ни с чем? Сегодня расскажем, как можно распознать сайт-фальшивку.

Что случилось?

Под конец года практически все интернет-магазины объявляют скидки — всевозможные «чёрные» дни недели, на которых можно купить вещи, технику или подарки к Новому году и Рождеству.

Во время распродаж также обостряется проблема мошенничества в Сети: злоумышленники «объявляют скидки» и создают липовые сайты. Как сообщает СМИ, в этом году всего за один день в Рунете зарегистрировали 192 сайта, которые маскируются под домены популярных магазинов с помощью преписки “OFF”. Например, FAMILIYA-OFF.RU вместо FAMILIYA.RU. Эксперты утверждают, что они будут использованы для фишинговых ресурсов. 

Фишинг (от английского слова “fishing” — рыбалка, рыбная ловля) — вид интернет-мошенничества, когда злоумышленники пытаются получить личные данные пользователей. 

Проще говоря — сайты мошенников сделаны для «ловли» невнимательных покупателей, которые будут массово закупаться во время распродаж. Используя такие сайты-клоны, аферисты могут получать доступ к личным банковским картам пользователей, а потом обнулять их счета. Или получать деньги за товар, существующий только на страницах липового сайта. 

Согласно данным Службы кибербезопасности Сбербанка, 48% людей, которые получают письма от неизвестных источников, переходили на фишинговые ресурсы, где вводили свои логины, пароли и данные карт.

Если вы совершите покупку на сайте мошенника, то отстоять свои права в суде будет практически невозможно. Всё дело в том, что между фейковым магазином и покупателем ожидаемо нет письменного договора, кассового чека или другого подтверждения покупки. Всё что остаётся — проявлять бдительность и наловчиться распознавать ресурсы-подделки. Этому и будем учиться сегодня. 

Как определить сайт мошенника?

Создатели фишинговых ресурсов отвлекают покупателя от изучения страницы и поиска каких-либо признаков подделки. Поэтому мошенники отслеживают «хайповые» темы и пытаются играть на человеческих эмоциях. И тут их целый спектр: можно надавить на жадность и предложить выиграть крутой гаджет или денежный приз, можно сыграть и на чувстве страха. Например, сайт может предложить проверить, не числится ли банковская карта в реестре украденных хакерами данных. И для этого всё, что нужно — ввести ваши данные. 

Итак, как распознать фишинговый сайт? Рассказываем!

Проверьте SSL-сертификат 

Это самая простая проверка, которую можно выполнить, если веб-ресурс кажется подозрительным. В первую очередь смотрите на наличие SSL-сертификата — есть ли заветная буковка “s” после http или нет. Кроме того, обратите внимание на изображения «замочка» в адресной строке, есть ли он.

Безопасное соединение с сервером особенно актуально при передаче конфиденциальной информации и персональных данных, например, паспортных. А вот если сайт начинается на «http://» — это повод усомниться в оригинальности страницы. 

К сожалению, вместе с развитием технологий, развивают свой арсенал и мошенники. И сегодня им не составит труда получить действительный SSL-сертификат даже для подделки. Поэтому, чтобы точно удостовериться в правомерности ресурса придётся капнуть чуть глубже. 

Нажмите на «замочек», чтобы узнать подробные  сведения о сертификате:

  • Важно проверить тип сертификата. Если вы видите OV или EV сертификат — это 99,999% гарантия того, что перед вами сайт-оригинал. Это же докажет, что  указанная в сведениях организация, для которой выдали сертификат — не подделка.

DV-сертификат (Domain Validation) — базовый уровень сертификата, который подтверждает существование домена, но не подтверждает существование организации.

OV-сертификат (Organization Validation) — сертификат, который подтверждает существование организации.

EV-сертификат (Extended Validation) — эффективное и престижное решение, которое активно применяется в онлайн-бизнесе.

  • Обратите внимание на провайдера (вендора/УЦ — удостоверяющего центра). Сегодня существует возможность самостоятельно получить бесплатный SSL-сертификат на проекте Let’s Encrypt (LE), он выпускается на 3 месяца и далее требует продления. Если вы видите, что перед вами сайт с LE-сертификатом — задумайтесь, довольно часто их выбирают мошенники, чтобы вызвать доверие пользователей. Мошенники вряд ли будут связываться с авторитетным УЦ да ещё и платить за то, что можно получить бесплатно. 

Никогда, никогда, никогда не переходите на сайт, если браузер сообщает вам о проблемах или о том, что УЦ, выдавший сертификат, неизвестен браузеру.

Запомнили? Поехали проверять сайт дальше. 🙂

Посмотрите на доменное имя 

Злоумышленники часто пытаются регистрировать похожие домены. Поэтому, важно внимательно присмотреться к названию сайта. Если в домене ошибка или опечатка — вас обманывают. 

На что же стоит обратить внимание при проверке домена: 

  • Пытаясь запутать пользователей, злоумышленники часто заменяют буквы символами — например, цифра «1» вместо буквы “I”: ONL1NE , а не ONLINE.
  • Имя сайта-клона может быть максимально приближено к реальному написанию бренда, но иметь незначительные опечатки. Например, вместо ONLINE.SBERBANK.RU можно увидеть ONLLINESBERBANK.RU или ONLINE.SBRBANK.RU — тут вам и замена букв, и пропуск символов.
  • Некоторые могут правильно написать домен, но использовать для этого иной алфавит. В таком случае буквы в адресной строке выглядят как латинские, но на самом деле название сайта набрано на алфавите другого языка. Обнаружить такую подделку тяжелее всего. 
  • Также стоит обратить внимание на доменную зону — фейковый сайт может располагаться в нестандартной для компании зоне, например, REG.SUPPORT, REG.BILLING вместо REG.RU. 

Узнайте, кто владеет сайтом

Другой способ отличить подделку — посмотреть, когда зарегистрирован домен. Если вы попали на ресурс крупного бренда с многолетней историей, то высока вероятность, что это безопасный сайт.

Кстати, проверить подозрительные сайты можно в REG.RU, используя сервис История Whois. 

К сожалению, это не гарантия. Совсем недавно исследованием поделилась международная компания Group-IB, специализирующаяся на предотвращении кибератак. Хакеры создали схему, по которой через кражу легальных доменных имен проводили фишинговые атаки на россиян. Их жертвами стали владельцы сайтов, которые забыли продлить свой домен. Мошенники следят за такими именами и в нужный момент размещают свой контент через процедуру «перехвата». В результате и на оригинальных ресурсах стала возможна кража денег, данных банковских карт или рассылка писем с вредоносными вложениями. 

Профилактика против «угона» домена достаточно проста — достаточно следить за сроком оплаты своего хостинга и вовремя его продлевать. А посетителям ресурсов важно быть внимательными и проверять подозрительные сайты по всем возможным параметрам, например описанным в этом материале.

Посмотрите на ошибки

Отличной уликой против обманщиков может стать проверка содержания сайта. Создание веб-ресурса — это проект, в который разные команды вкладывают огромное количество времени и энергии. Поэтому ошибки и опечатки там если и встречаются, то редко. Чего не скажешь о мошеннических ресурсах. 

Если на сайте слишком много грамматических ошибок, изображений с низким разрешением, в целом устаревший дизайн или слишком много рекламы, то, скорее всего, вы попали на сайт-копию. Просмотрите несколько страниц с товарами на предмет ошибок, проверьте правильное написание названия организации. Также стоит обратить внимание на поехавшую вёрстку и неправильное использование цветов в дизайне.

Проверьте платёжные формы

Если для регистрации на сайте вас просят указать данные банковских карт, логин и пароль от вашей почты — закройте эту страницу немедленно.

Также посмотрите на наличие ссылок на странице. Если при клике на них вас перебрасывает на непохожие на оригинальный сайт страницы, то вы попали «в лапы» мошенников. Просто закройте вкладку и ни в коем случае не вводите персональные данные в платёжную форму.

Также злоумышленники в качестве систем оплаты часто используют Яндекс.Кошельки или QIWI-кошельки. Если при выборе оплаты вас перебрасывает на такой сервис, лучше лишний раз всё перепроверить, чтобы не оплатить «несуществующую» покупку. 

Найдите пользовательские соглашения 

Проверьте, есть ли на сайте пользовательское соглашение, условия оплаты и доставки, если они предусмотрены, а также политики обработки персональных данных. Тут важно проверить не только их наличие, но и сам текст. В пользовательском соглашении не должны быть указаны сторонние компании, которые не имеют отношения к сайту.

Также стоит проверить контактные телефоны и публично размещённые реквизиты компании (адрес, фирменное название). Запомните: через сайт продавец реализует дистанционную продажу товаров или услуг , а значит он обязан указать на сайте базовые реквизиты о себе как продавце (фирменное наименование, адрес местонахождения, ИНН и так далее). Не нашли ничего из этого? Срочно закрываем сайт.

Спросите у Google

Компания Google разработала инструмент для проверки сайтов. Достаточно ввести в форму адрес сайта и вы получите информацию о безопасности ресурса. 

Почитайте отзывы

Проверяйте отзывы о магазине в Сети, особенно если компания позиционирует себя крупным игроком рынка.

а) Если интернет-магазин интегрирован в Яндекс.Маркет, то вы увидите отзывы о нём. На этой площадке они проходят очень плотную проверку на свою подлинность фирменными алгоритмами Яндекс.Маркета, а «левые», накрученные отзывы — сразу же отсеиваются. 

б) Существует множество ресурсов с реальными отзывами, например, Отзовик или Лохотрона.нет. На них точно можно распознать сайт-фальшивку, потому что в выдаче старый и очевидный фишинг сидит с заниженными оценками, а в комментариях бунтуют и негодуют пользователи.

в) Независимые отзывы можно найти на форумах и в группах соцсетей этого магазина. Если вы видите живую переписку в настоящем времени (этого года или месяца условно) — ставьте плюсик в копилку подлинности сайта. 

Что делать, если вы всё же отправили пароли или данные карточки?

Если вы всё же попались на удочку мошенников, но вовремя это поняли — ваши данные ещё можно спасти.

Первым делом — поменяйте пароли, которые вы успели указать. Сделать это нужно максимально быстро. И не забудьте заменить пароли на других сайтах, если вы использовали одинаковый шифр. 

Если вы отправили свои платёжные данные, то обязательно свяжитесь со службой безопасности банка. Как правило, банки просто заблокируют на время платежи с вашей карты, что позволит сохранить деньги.

Как пожаловаться на сайт мошенников?

Предположим, что вы всё-таки попали на фишинговый сайт, но сумели вовремя распознать его. Тогда вы можете помочь компаниям и поисковым системам заблокировать этот ресурс, чтобы другие люди не пострадали.

Свяжитесь с администраторами оригинального сайта

Передавать информацию о мошенническом ресурсе можно и нужно владельцам оригинального сайта (если бренд, под который маскируются злоумышленники, существует). На всех официальных сайтах есть раздел «Контакты» или «Помощь», в которых можно найти электронную почту компании. Далее, нужно заполнить форму обратной связи и поделиться информацией о фишинговом сайте. Электронные адреса оригинальных компаний обычно начинаются со слов “support” или “info”.

Например, в REG.RU есть отдельный блок «Сообщить о нарушении», в котором вы сможете узнать, куда стоит обратиться, если ваши права были нарушены в международных зонах или в доменах .RU/.РФ/.SU. 

Сообщите поисковой системе

У Google и Яндекс есть специальные формы, через которые можно пожаловаться на фишинговые сайты. Нужно потратить всего лишь минуту времени, чтобы помочь защитить других пользователей от обманщиков. 

Профилактика: как защитить себя от мошенников

Установите антивирус. Если вы всё ещё не установили антивирус — сделайте это сейчас! Во всех крупных антивирусах есть встроенная проверка на фишинг, достаточно только её настроить и включить.

Оформите виртуальную карту для покупок онлайн. Такая карта не имеет физического носителя и выпускается только в цифровом виде. Привязана она к вашему основному счёту, но имеет другие реквизиты. Используя такую карту, вы не «светите» свои личные данные. 

Подключите двухфакторную аутентификации. Двойная защита на сервисах, запрашивающих проверку захода в личный кабинет по двум параметрам: через логин, пароль и, например, по коду смс.

Используйте браузеры Chrome, Safari, Firefox. Они уже имеют антифишинговую защиту.

И снова — сохраняйте бдительность. Надеемся, вы поняли, что к сайтам нужно относиться с осторожностью.

⌘⌘⌘

Надеемся, что наш пост поможет вам защитить себя от мошенников. И, конечно же, желаем вам удачных покупок не только в чёрную пятницу, но и всегда! 

Проверка сайта на мошенников

Каждый день в сеть запускается больше миллиона интернет проектов, которые зарегистрированы во всех точках мира. Далеко не каждому из них можно доверять, но как понять, надежность сайта? Перед работой на неизвестном сайте, нужно обязательно его проверить. Мошенничество в интернете сейчас продолжает процветать, несмотря на ожесточенную борьбу с ним. Все чаще пользователи сети Интернет сталкиваются с мошенничеством. Проверка сайта на мошенников легко осуществима на ресурсе https://service.loxotrona.net/ , с помощью которого вы легко и быстро сможете проверить любой интересующий вас сайт. Миссия проекта — оградить добропорядочных людей от аферистов в сети интернет. Для того чтобы проверить сайт на мошенническую историю, скопируйте адрес сайта, вставьте в поле проверки и нажмите на кнопку «Проверить сайт», всего через несколько секунд вы сможете узнать всю информацию об интересующих вас ресурсе. С помощью данного ресурса, вы сможете решить, стоит ли использовать ресурс или же он является ненадежным.

Мошенники существуют столько, сколько существует общество. Мошенники для того, чтобы заполучить ваши личные данные совершенствуются и сегодня имеют в своем распоряжении больше инструментов, чем когда-либо прежде, поэтому никогда не вводите свои данные на ненадежном сайте. Каждый день в сеть запускается больше миллиона интернет проектов, которые зарегистрированы во всех точках мира. Сейчас мошенники проникают в кошелек с помощью интернета, предлагая доверчивым гражданам услуги. На данном ресурсе вы можете обратиться к разделу «Вопрос — ответ», где любой обратившийся с вопросом человек, получит ответ о нашем доверии к тому или иному проекту.

Если вы уже встречались со случаями мошенничества в сети, вы можете оставить жалобу на какой-либо сайт и этим вы поможете другим пользователям и убережете их от опасности. Даже если интерфейс сайта не вызывает подозрений, его могли создать с целью незаконного присвоения денег пользователя, поэтому всегда нужно быть во внимании. Даже если внешний вид сайта не вызывает подозрения, его создатель может оказаться вором, цель которого – ваши деньги, поэтому лучше сразу проверить сайт с помощью данного ресурса. В случае, если в адресе что-то не так или наводит на подозрения, то стоит избегать этого портала.

7 способов, как проверить сайт на мошенничество онлайн в 2019 году

Выбор редакции

Рассмотрим лучшие сервисы, которые помогут узнать, как проверить сайт на мошенничество в режиме онлайн.

С их помощью вы сможете решить, стоит ли использовать ресурс или же он является ненадежным.

С каждым годом в интернете создается более 10 000 различных интернет-магазинов и торговых площадок. Не все они могут оказаться надежными.

Как результат, деньги легко утекут к мошеннику, а обычный покупатель не сможет ничего доказать.

Очень легко столкнуться с мошенничеством в интернете.  Даже если внешний вид сайта не вызывает подозрения, его создатель может оказаться вором, цель которого – ваши деньги. Схем обмана существует огромное количество – от создания фишинговых сайтов, до липовых интернет-магазинов и почтовых рассылок с вредоносными ссылками.

Cодержание:

Далее рассмотрены лучшие сервисы для проверки сайтов и приведены полезные рекомендации, которые помогут выявить характерные черты мошеннического ресурса.

1 Сервис WebMoney Advisor

Ссылка: https://advisor.wmtransfer.com/description.aspx

WebMoney Advisor – это популярный сервис для проверки надежности сайта. Разработан он командой WebMoney для пользователей сервиса. Идея сканера – указать пользователю, может ли он доверять определенному сайт и перечислять свои деньги на счет продавца.

Рекомендуем начать проверку именно с WebMoney Advisor. В главном окне сайта найдите текстовое поле для ввода адреса и скопируйте в него ссылку на сайт:

Рис.2 – главная страница WebMoney Advisor

Далее нажмите на клавишу «Найти сайт», чтобы начать процесс сканирования. В новом окне появится информация о ресурсе.

Если сайт окажется мошенническим и опасным для использования, вы увидите соответствующее системное сообщение.

Также, с помощью сервиса можно посмотреть положительные и негативные отзывы, место в рейтинге сайтов и индекс посещаемости. Если вы просканировали сайт, но для него не найдены отзывы и показывается нулевой рейтинг, это тоже говорит о ненадежности ресурса.

Рис.3 – результат проверки

Для автоматического сканирования всех посещаемых вами сайтов рекомендуем установить расширение WebMoney Advisor, которое доступно для браузеров Chrome, Opera, Firefox, Yandex.

к содержанию ↑

2 WhoIS – проверка регистрации сайта

Ссылка: https://www.imena.ua/site/domains/whois

WhoIS – это сервис, который позволяет узнать, в какой стране зарегистрирован домен, и кто является поставщиком услуг хостинга. Такой инструмент будет полезен тем пользователям, которые уже столкнулись с фактом мошенничества и хотят выйти на преступника.

Узнав, кто именно поддерживает сайт, вы сможете написать хостинг-провайдеру и получить информацию о человеке, который вас обманул. Конечно же, все данные будут предоставлены только при условии, если вы докажете, что были обмануты.

Как показывает практика, вполне реально выявить человека, заявить на него в полицию и добиться блокировки сайта.

Для начала использования ресурса перейдите на его главную страницу и в строке «Домен» введите адрес сайта. Нажмите «ОК» для подтверждения:

Рис.4 – сервис WhoIS

В новом окне будет показана сводка о домене. Вы узнаете, какая компания зарегистрировала доменное имя, дату создания сайта, имя владельца, город и статус работы.

Также, вы увидите номера телефонов, с помощью которых можно попытаться связаться с владельцем ресурса (если при регистрации он указал действительный номер).

Рис.5 – результаты поиска с WhoIS

к содержанию ↑

3 Инструмент TrustOrg.com

Ссылка: https://довериевсети.рф

Trustorg (или «Доверие в Сети») – это ресурс, который позволяет определить уровень доверия сайта в интернете. С его помощью вы сможете быстро узнать, стоит ли делать покупку в онлайн-магазине.

«Доверие в Сети» показывает:

  • Возраст домена;
  • Местоположение IP-адреса;
  • Уникальный рейтинг доверия;
  • Репутацию сайта.

Анализ проводится на основе комплексного использования надежных технологий проверки. В частности, Яндекс Каталога, Web Of Trust, Safe Browsing. Также, пользователи ресурса могут увидеть зарегистрированные владельцем номера телефонов и адреса офисов.

Другие люди могут оставлять отзывы об использовании веб-сайта, с помощью которых вы сможете точно определить, стоит ли пользоваться товарами и услугами выбранного ресурса.

На главной страничке введите адрес сайта и нажмите на «Проверка сайта»:

Рис.6 – главная страница TrustOrg

Как видите, в результатах сканирования для сайта показан отрицательный уровень траста, что говорит о мошенничестве. Также, на странице видно возраст домена в днях, местоположение сайта и его описание.

Рис.7 – сканирование с TrustOrg

https://www.youtube.com/watch?v=oYfHgcC1iBk

к содержанию ↑

4 Узнаем репутацию сайта на WebOfTrust

Ссылка: https://www.mywot.com/ru/

Web of Trust (или WoT) – это международный ресурс проверки сайтов. Его база данных содержит около миллиона сайтов от всех популярных провайдеров.

Контролер сайтов защитит ваш компьютер от вирусов, скама, фишинга и подозрительных программных алгоритмов.

Особенностью ресурса является то, что он предназначен для работы только в качестве расширения для веб-браузера.

На официальном сайте сервиса есть ссылка для установки утилиты в ваш браузер и детальная информация о работе и принципах внедрения API, которые пригодятся разработчикам.

Рис.8 – главная страница WoT

После нажатия на клавишу добавления расширения вы будете перенаправлены в официальный магазин дополнений браузера.

С его помощью можно безопасно установить нужное расширение. Добавление сервиса проверки начнется автоматически.

В окне браузера появиться значок программы. Теперь посещение всех сайтов будет контролироваться расширением. Если ресурс безопасен — ничего не произойдёт, а в случае выявления фишинга или скама – появится соответствующее уведомление и доступ к сайту будет заблокирован. В любой момент пользователь может отключить работу дополнения.

Рис.9 — установленное в браузере расширение WoT

Для просмотра уровня траста откройте нужный сайт, затем кликните на иконку расширения и выберите поле «Посмотреть репутацию и комментарии».

к содержанию ↑

5 Проверка адресов сайтов с Dr. Web

Ссылка: https://vms.drweb.ru/online/

Разработчики одного из самых популярных антивирусов недавно запустили инструмент быстрой проверки ссылок на любые сайты и страницы.

Плюсом онлайн-сканера является то, что его можно использовать как на компьютере, так и на мобильном устройстве.

Сайт использует только надежные алгоритмы, которые работают и в полной версии антивируса.

Чтобы начать сканирование, введите ссылку на страницу в поле «Проверить» и нажмите Enter.

Рис.10 – главная страница сканера от Dr. Web

Далее появится всплывающее окно с результатами работы сайта:

к содержанию ↑

6 Google Safe Browsing

Ссылка: https://chrome.google.com/webstore/detail/google-safe-browsing/ocnmoefelkcepadlbpbgemdjiifailke?hl=ru

Google Safe Browsing – это лучшее расширение для Хром, которое позволяет взаимодействовать с новейшим алгоритмом безопасного интернет-сёрфинга от Гугл. Для начала использования аддона, установите его с помощью официального магазина дополнений.

Для сканирования достаточно перейти на сайт и нажать на клавишу расширения, которая находится на панели управления браузера.

Также, можно настроить автоматическую проверку посещаемых ресурсов.

Аналогичные технологии безопасного использования интернета есть у Yandex и FireFox.

к содержанию ↑

7 VirusTotal – универсальное сканирование

Ссылка: https://www.virustotal.com/#/home/upload

Virus Total – это сервис, который позволяет без установки ПО проверить файлы, ссылки, IP-адреса или домены на вирусы.

После перехода на страницу ресурса нужно выбрать вкладку, которая соответствует объекту сканирования:

  • File – для мультимедиа файлов и различных документов;
  • URL – для ссылок;
  • Search – для получения информации об адресе, домене.

Так как нам нужно проверить сайт, выберем вкладку URL. В текстовое поле нужно скопировать ссылку на ресурс.

Рис.13 – сервис Virus Total

В новом окне вы увидите перечень всех возможных угроз и результаты их проверки:

https://www.youtube.com/watch?v=EMK1VRCCzvk

к содержанию ↑

Практические рекомендации

Сайт – это лицо фирмы в интернете. Именно по сайту можно выявить, сколько лет компания работает и как себя представляет.

Также, на большинстве сайтов можно прочитать отзывы от клиентов.

Важно понимать, что надежная компания будет иметь исключительно качественный и продуманный веб-сайт, в то время как владельцы мошеннических контор предпочитают не вкладывать деньги в собственные сайты или же делают их некачественно.

Рассмотренные выше сервисы хоть и способны проверить траст сайта, его возраст, надежность домена, но все эти параметры являются абстрактными и нельзя в полной мере судить о безопасности сайта, отталкиваясь только от результатов сканирования:

  • Небольшой возраст сайта. Нельзя исключать возможность, что компания совсем недавно запустила свой собственный ресурс, так как сама является новой. Также, существуют случаи, когда сайт просто переезжает на новый домен, поэтому его возраст обнуляется;
  • Отзывы. Если же вы уверенны, что сайт надежный, потому что имеет только положительные отзывы, мы бы рекомендовали еще раз проверить ресурс. Дело в том, что владельцы мошеннических сайтов часто накручивают положительные отзывы клиентов, чтобы вас запутать. После получения негативного комментария ресурсы часто удаляются и создаются заново. Именно поэтому комментариям не всегда можно доверять;
  • Незащищенное соединение. Браузер может автоматически определять подключение к сайту ненадежным, даже если ранее вы уже использовали ресурс и на 100% уверенны в его честности. Такое происходит из-за сбоя в работе алгоритма проверки.

к содержанию ↑

Дополнительные рекоммендации

Как видите, использование сервисов для проверки сайта на мошенничество не является панацеей, которая гарантировано защитит вас от обмана.

Рекомендуем дополнительно выполнять такие действия:

  • Искать отзывы на посторонних независимых площадках;

Рекомендации пользователей, которые можно найти на специальных ресурсах для проверки сайта, не всегда являются на 100% верными. Сплошные хвалебные комментарии могут свидетельствовать и о накрутке.

Как правило, если пользователь приобрел товар и его все устроило, он не будет искать специальные сервисы проверки сайта на мошенничество и оставлять там хороший комментарий. А вот человек, которого развели на деньги, всегда оставит негативный отзыв.

Все отзывы, которые действительно могут быть полезными, размещаются в Google или Yandex.

Когда вы вводите имя компании в поисковой системе, результаты выдачи показывают окно отзывов вместе с адресом организации, номером телефона и графиком работы.

Пример просмотра отзывов от Google для одного из интернет-магазинов:

Рис.16 – отзывы Google

  • Просмотр описания товара;

Сайт, который продает реальный товар, будет иметь много фотографий продукции в различных ракурсах.

В описании товара вы найдете абсолютно все характеристики, состав или другие свойства предмета. А вот мошенники не тратят свое время на создание детальных описаний.

  • Проверка страниц в социальных сетях;

Любая уважающая себя компания имеет верифицированные страницы в социальных сетях. Это могут быть Вконтакте, Фейсбук, Инстаграм и другие сети.

Проверьте эти странички. На них другие покупатели часто делятся фотографиями товаров, пишут отзывы.

Так вы сможете получить максимально объективную оценку работы выбранного сайта.

Если же ссылок на социальные сети нет, это довольно подозрительно, ведь есть вероятность того, что владелец сайта не хочет, чтобы люди оценивали компанию и высказывали свои мнения.

  • Связаться с менеджерами компании.

Если ранее вы или ваши знакомые не пользовались услугами выбранного сайта и отзывов в интернете нет, всегда можно попробовать связаться со службой поддержки клиентов по телефону. Надежная компания всегда создает свои собственные кол-центры.

По указанному в форме контактов номеру не удалось дозвониться? Скорее всего, все номера и электронные адреса – это фейк.

Также, настоятельно рекомендуем никогда не покупать товар по предоплате на новом для вас сайте, даже если он всем известен и имеет хороший уровень доверия. Первую покупку лучше оформлять наложенным платежом или отправлять деньги только по факту получения услуги.

к содержанию ↑

Выводы

Перед использованием нового неизвестного вам интернет-магазина, банковского сайта или любой другой площадки, которая предусматривает проведение операций с деньгами, рекомендуем проверить сайт всеми указанными в статье сервисами.

Это займет немного времени, но риск попасться в очередную интернет-аферу будет сведен к минимуму.  Также, не забывайте о том, что нужно проверять название сайта в поисковых системах и читать отзывы из независимых источников.

Всегда будьте бдительны и примите во внимание тот факт, что подозрительно низкие цены на товары – это первое свойство всех мошеннических сайтов, поэтому всегда проверяйте среднюю стоимость продукции или услуги в других магазинах.

Тематические видеоролики:

Как проверить подлинность компании | Малый бизнес

Автор Chron Contributor Обновлено 10 августа 2020 г.

Для малого бизнеса взаимодействие с ненастоящей компанией может быть разрушительным. Например, поставщик, которого не существует, может стоить малому бизнесу времени и денег. Работа с такой компанией может обречь на гибель даже малый бизнес, у которого нет средств для компенсации убытков. Проверить фирму, прежде чем вести с ней дела, жизненно важно, но это не так просто, как может показаться.К счастью, существуют источники, которые помогут вам определить, настоящий ли бизнес, или просто уйти, прежде чем вы обожжетесь.

Поиск в Better Business Bureau

Введите название компании в поле «Искать» в верхней части страницы поиска Better Business Bureau. Введите город, штат или почтовый индекс в поле в правом верхнем углу страницы. Вы также можете ввести адрес электронной почты компании или даже ее номер телефона, чтобы отобразить только конкретную компанию, которую вы ищете.

Если название фирмы, которую вы исследуете, встречается довольно часто, поиск может привести к появлению множества списков. Например, введите «Microsoft», и вы увидите 37 списков, некоторые из которых относятся к известной компьютерной компании в Редмонде, штат Вашингтон, а другие — к фирмам из разных мест, не все из которых не аккредитованы Better Business Bureau.

Если компания, которую вы ищете, входит в такой список, проверьте ее рейтинг и спросите компанию о любых жалобах, которые были поданы против нее.Фирмы оцениваются по шкале от A + до F, поэтому вы можете сразу увидеть, есть ли какие-либо проблемы.

Проверить компанию в Интернете

Воспользуйтесь услугами таких фирм, как Glo-Bis, чтобы получить информацию о любой компании по всему миру, включая информацию о балансе, отчетах о доходах и судебных разбирательствах. Сборы начинаются от $ 265 .

Министерство торговли США также предоставляет отчеты о компаниях во всем мире через веб-сайт Export.губ. Отчеты, которые обычно доставляются примерно за 10 дней, включают информацию о названии компании, адресе и ключевом контактном лице, типе бизнеса, количестве сотрудников, году основания и деловой / финансовой репутации.

Проверяйте такие фирмы, как Dun & Bradstreet, на предмет приобретения информационных и / или кредитных отчетов американских или международных фирм.

Проверить статус EIN

Проверить компанию через идентификационный номер работодателя или EIN. Практически все предприятия должны иметь этот девятизначный номер, который Налоговая служба использует для идентификации налоговых счетов работодателей и некоторых малых предприятий, у которых нет сотрудников.Найдите компанию по ее EIN на таких веб-сайтах, как EIN Finder.

Если компания заявляет, что у нее нет EIN, спросите, почему. Кроме того, найдите компании по их налоговым номерам штата, чтобы определить, являются ли они подлинными.

Бесплатный поиск по названию компании

Проверьте адрес и номер телефона компании. Убедитесь, что номер телефона и компания совпадают с помощью таких сайтов, как White Pages. Введите номер телефона компании в обратном телефонном справочнике сайта. Откроется адрес компании.Если адрес не совпадает с предоставленной вам информацией о компании, спросите должностных лиц компании о несоответствии. Если компания не может объяснить несоответствие, например наличие нескольких мест, может быть проблема.

Проверить ссылки. Иногда компании размещают ссылки / обзоры на своих веб-сайтах. Если да, попросите контактный номер и позвоните или напишите по электронной почте человеку или компании, дающей ссылку. Или попросите ссылки, включая номера телефонов и адреса электронной почты.Если у компании нет рекомендаций или она отказывается их предоставить, выберите другую компанию.

Как протестировать веб-сайт вашей компании

Итак, вы создали совершенно новый веб-сайт, что потребовало много времени, денег и / или ресурсов. Как только вы запустите его, вы получите сообщение от кого-то о том, что на главной странице есть огромная орфографическая ошибка . Вы это проверите. В процессе вы понимаете, что ваши изображения выглядят зернистыми, и их действительно трудно читать на экране телефона. Всего этого можно было бы избежать при тестировании своего сайта.

Что такое тестирование сайта?

Тестирование веб-сайта можно охарактеризовать как устранение неполадок. Когда вы разрабатываете веб-сайт, вам необходимо найти проблемы, которые могут быть где-то на вашем веб-сайте, прежде чем он станет общедоступным. Путем тестирования можно решить и исправить такие проблемы, как базовая функциональность веб-сайта, доступность для пользователей и способность сайта адаптироваться к различным устройствам (например, смартфонам, планшетам и настольным устройствам) до запуска вашего веб-сайта.Мы делаем это для каждого создаваемого веб-сайта перед его запуском.

На что я должен обращать внимание при тестировании своего сайта?
  • Отзывчивость
  • Внешний вид и поток
  • Грамматика и правописание
  • Ссылки
  • Контактные формы

Когда вы будете готовы протестировать свой веб-сайт, обязательно просмотрите все страницы, которые должны быть доступны. Когда вы открываете каждую страницу, вам следует обратить внимание на ряд вещей, включая макет страницы, то, как работают элементы и как они выглядят на разных устройствах.Прочтите, чтобы узнать, что вам следует протестировать.

Оперативность

Тот факт, что ваш веб-сайт отлично выглядит в Google Chrome на рабочем столе, не означает, что он будет выглядеть так же на мобильном устройстве или даже в другом браузере. Проверьте каждую ссылку в Chrome, Firefox, Internet Explorer, а также на мобильных и планшетных устройствах. Как ваши страницы отображаются, когда вы их открываете? Если некоторые изображения смещены по центру на мобильных устройствах, но выглядят нормально во всех браузерах для настольных компьютеров, это красный флаг, что что-то нужно исправить.Найдите время, чтобы исправить эти проблемы; ваши мобильные посетители не потерпят плохого опыта.

Внешний вид и поток

Другими словами, это верстка и дизайн. Это может быть сложно решить, если вы не знакомы со всем, что нужно для создания красивого веб-сайта. Вот на что следует обратить внимание при оценке внешнего вида и расхода:

  • изображений
  • белое пространство
  • расстояние между элементами
  • шрифт и интервал между текстом
  • иерархия элементов
  • отступы и поля
  • форматирование шрифта

В основном, убедитесь, что все выглядит правильно.Все должно быть согласовано и иметь смысл для ваших пользователей. Не позволяйте румяной строке текста с отступом скользить, потому что «это не так уж плохо», потому что это важно для ваших посетителей.

Грамматика и правописание

Не думайте, что все будут читать ваши написанные материалы. Фактически, большинство людей этого не делает. Однако, если кто-то читает ваш контент на вашем веб-сайте, на написание которого вы потратили много времени, это означает, что они взаимодействуют с вашим брендом. Вот почему так важно убедиться, что в вашем тексте нет орфографических и грамматических ошибок.Было бы полезно, если бы кто-то другой просмотрел ваш контент и действовал как вторая пара глаз, поскольку легко не заметить ошибки в контенте, с которым вы работали какое-то время.

Ссылки

Нет ничего более раздражающего, чем посещение веб-сайта, нажатие на значок социальной сети и переход на совершенно нерелевантную страницу, страницу с ошибкой 404 или отсутствие страницы вообще. Также неприятно, если вы нажимаете внешнюю ссылку (ссылку, которая ведет на другой веб-сайт или приложение), и она открывается на той же вкладке, на которой был ваш веб-сайт.Теперь вам нужно нажать кнопку «Назад», чтобы вернуться на сайт, на котором вы только что были. Плохие ссылки — это один из основных способов потерять заинтересованного потенциального клиента или клиента. Вот как вы можете убедиться, что ваши ссылки работают:

  1. Нажмите на каждую текстовую ссылку или связанное изображение
  2. Убедитесь, что он работает
  3. Убедитесь, что это актуально
  4. Если он ссылается на другую из ваших страниц, он должен открываться на той же вкладке
  5. Если он ведет на другой веб-сайт, он должен открываться на другой вкладке
  6. Исправьте ошибки
  7. Обновить страницу

Формы Формы

— это все, что может быть заполнено кем-либо на вашем веб-сайте.Сюда входят формы сообщений, контактные формы и приложения.

Заполните каждую контактную форму, чтобы убедиться, что они работают. Сначала попробуйте отправить его без какой-либо информации (это не должно работать). Затем медленно заполняйте его, пока не будете уверены, что получите нужную информацию, когда кто-то отправит ее в реальном мире. Формы тестирования важны, потому что иногда формы могут быть отправлены без ключевой информации о потенциальных клиентах, такой как адрес электронной почты или номер телефона. После нажатия кнопки «Отправить» убедитесь, что отображается правильная страница или сообщение с благодарностью.Затем проверьте электронную почту, связанную с этой формой, чтобы убедиться, что ваш запрос действительно отправлен.

Итог

Если у вас есть проблемы в любой из этих областей, это признак того, что вам нужно внести некоторые изменения, если вы хотите, чтобы ваш веб-сайт был успешным. Когда вы обнаруживаете какие-либо проблемы до того, как сайт будет запущен, это сэкономит ваше время в долгосрочной перспективе и не оставит у посетителей плохого впечатления о вашей компании.

Ознакомьтесь с нашим руководством по редизайну веб-сайта

Вы думаете о редизайне сайта? Мы собрали 21 наш главный совет по успешному редизайну веб-сайта.Они просты для понимания и включают видео, ссылки, списки и примеры, которые помогут вам. Нажмите кнопку ниже, чтобы ознакомиться с руководством.

SEC.gov | Поиск компании Страница

Параметры соответствия поиска

Начинается с или Содержит

Номер файла

Для поиска по номеру файла название компании должно быть пустым.

Государственный
AlabamaAlaskaArizonaArkansasCaliforniaColoradoConnecticutDelawareDistrict из ColumbiaFloridaGeorgiaHawaiiIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUnited StatesUtahVermontVirginiaWashingtonWest VirginiaWisconsinWyomingAlberta, CanadaBritish Колумбия, CanadaManitoba, CanadaNew Brunswick, CanadaNewfoundland, CanadaNova Scotia, CanadaOntario, Остров CanadaPrince Эдвард, CanadaQuebec, CanadaSaskatchewan, CanadaYukon, Канада

Страна
AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA И BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA И HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH ИНДИЙСКИЙ ОКЕАН TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCAPE VERDECAYMAN ISLANDSCENTRAL АФРИКАНСКИЕ REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (Keeling) ISLANDSCOLOMBIACOMOROSCONGOCONGO, ДЕМОКРАТИЧЕСКАЯ РЕСПУБЛИКА THECOOK ISLANDSCOSTA RICACOTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICEAST TIMORECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ОСТРОВА (МАЛЬВИНСКИЕ) ФАРЕРСКИЕ ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH ЮЖНОЕ ТЕРРИТОРИИ ГАБОНГАМБИЯГЕОРГИЯ (Страна) ГЕРМАНИЯ CAN ГОРОД ШТАТ) HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, Исламская Республика OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKSTANKENYAKIRIBATIKOREA ДЕМОКРАТИЧЕСКАЯ НАРОДНАЯ РЕСПУБЛИКА OFKOREA, РЕСПУБЛИКА OFKUWAITKYRGYZSTANLAO НАРОДНАЯ ДЕМОКРАТИЧЕСКАЯ REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN АРАБСКИЕ JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAUMACEDONIA, БЫВШИЙ ЮГОСЛАВСКАЯ РЭП.OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, Федеративные Штаты OFMOLDOVA, РЕСПУБЛИКА OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN МАРИАНА ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN КРАЙ, OCCUPIEDPANAMAPAPUA НОВОГО GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT Киттс и NEVISSAINT LUCIASAINT Пьер и MIQUELONSAINT Винсент и GRENADINESSAMOASAN MARINOSAO ТОМ И PRINCIPESAUDI ARABIASENEGALSEYCHELLES СЬЕРРА LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH ГРУЗИЯ / СО.СЭНДВИЧ ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD И ЯН MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN АРАБСКИХ REPUBLICTAIWANTAJIKISTANTANZANIA, ОБЪЕДИНЕННАЯ РЕСПУБЛИКА OFTHAILANDTOGOTOKELAUTONGATRINIDAD И TOBAGOTUNISIATURKEYTURKMENISTANTURKS И CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED АРАБСКОГО EMIRATESUNITED KINGDOMUNITED Внешних Малые ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ОСТРОВ, BRITISHVIRGIN ОСТРОВ, U.S.WALLIS И FUTUNAWESTERN SAHARAYEMENYUGOSLAVIAZAMBIAZIMBABWEUNKNOWN
стандартных отраслевая классификация
Формы собственности 3, 4 и 5.

Включают Исключать Только


Меньше вариантов

5 лучших веб-сайтов для поиска информации о компании


Собираетесь на собеседование и не имеете ни малейшего представления об этой новой компании? Вы думаете, как пройти это интервью? Вы инвестор, пытаясь найти информацию о компании и заслужить доверие перед тем, как инвестировать? Или вы пишете статью о фирме и ищете информацию?

Сегодня я расскажу о различных сайтах, которые предоставляют такую ​​информацию.Эти веб-сайты, о которых я говорю, будут предоставлять информацию бесплатно. Вам нужно будет найти компанию в зависимости от отрасли и вашей области знаний.

Прежде чем говорить о сайтах, предоставляющих эту информацию, я хотел бы проинформировать вас об обработке информации.

База данных компаний будет хранить всю общедоступную информацию, которую компании предоставляют онлайн (через свои веб-сайты), через маркетинговые платформы, пресс-релизы и многие другие подобные платформы.

Вся эта информация будет собрана под названием компании и сохранена для вас, чтобы вы могли исследовать и найти их.Эта информация полезна в тех случаях, когда вы планируете купить компанию, пройти собеседование для этой конкретной компании или ищете инвестиции.

5 лучших веб-сайтов для поиска информации о компании

1. Отчетность по счетам

Разработанный командой разработчиков из Бангалора, Reporting Accounts — это сайт, на котором вы можете найти полезную корпоративную и отраслевую информацию, а также все остальное. остальную Корпоративную информацию можно найти в Отчетных счетах.Благодаря огромной базе данных этого веб-сайта здесь можно найти более 35000 компаний из 75 стран.

Информация, которую вы обычно ищете, — это анализ конкуренции, судебные разбирательства, новости международного бизнеса, расширения компании, дочерние компании и многое другое. Это простой, но эффективный веб-сайт с категориальным меню и удобным интерфейсом, в котором есть все, что вам нужно.

Этот сайт предлагает как бесплатные, так и платные услуги; это зависит от информации, которая вам нужна.Вы получите большую часть информации о компании, ничего не платя. Вам нужно будет заплатить только в том случае, если вам потребуется более подробная информация.

На главной странице вы найдете три отчета: отчеты компании, подписка — все отчеты и средние отраслевые отчеты.

• Отчеты компании в основном состоят из ежедневной корпоративной деятельности, которая интерпретирует результаты компании.

• Подписка все отчеты предлагают 2 услуги; глобальное базовое обслуживание и профессиональное обслуживание с обширными функциями соответственно.

• Отчеты в среднем по отрасли готовятся по 28 отраслям и 165 отдельным возможностям (регион, страна и весь мир)

2. Google News

Это не совсем поставщик информации о компании. Однако гигант поисковой системы действительно размещает этот канал для хранения любой информации, связанной с компаниями. Вы можете найти важную информацию, такую ​​как пресс-релизы, финансовая информация, незавершенные судебные разбирательства и многое другое.

Благодаря эффективному пользовательскому интерфейсу Google предлагает всю необходимую информацию для компании.

Хотя невозможно найти профиль компании, вы найдете всю необходимую информацию, необходимую для принятия разумных инвестиционных решений или даже если вы готовы купить компанию или ее дочерние компании.

Хорошо известная поисковая машина обеспечит поиск и отображение точной информации в соответствии с вашими ключевыми словами.

Однако вам нужно будет отсортировать необходимую информацию, поскольку она будет предоставлять результаты поиска на основе критериев, а алгоритм поиска обеспечивает эффективные результаты за считанные секунды при поиске по всей всемирной паутине.

3. Найдите компанию

Еще один отличный информационный центр для компаний — это Find the Company. Любая информация о компании, которую вы ищете, доступна здесь. Домашняя страница говорит сама за себя и не нуждается в представлении; однако я расскажу о некоторых эксклюзивных функциях этого веб-сайта.

На главной странице есть опция поиска с множеством поисковых фильтров; выберите один или несколько фильтров в зависимости от ваших критериев поиска. Вам будет предоставлена ​​точная информация о компании на основе корпоративной разведки.

Статьи на основе данных с визуализацией и исследовательскими инструментами, которые вы можете использовать, безусловно, являются здесь преимуществом, и вы найдете компанию в кратчайшие сроки.

Company Research предлагает на ваш выбор более 15-20 вариантов; включая профсоюзы, индексы фондового рынка, транспортные компании и многие другие отрасли.

Инструменты исследования, к которым у вас есть доступ, можно использовать для получения как можно большего объема информации в зависимости от того, насколько хорошо вы их используете.

4.LinkedIn

Платформа социальных сетей LinkedIn использовалась в основном для приема на работу и демонстрации ваших навыков в области ИТ, но также включает в себя всю отраслевую информацию. Уникальной функцией, предлагаемой на этом сайте, является поиск компаний.

Наиболее частые обновления компаний на веб-сайтах заслуживают похвалы, так как существует бесчисленное множество компаний и ежедневно вносятся бесчисленные изменения, поэтому отслеживать их и соответственно обновлять — непростая задача.

Зарегистрированный участник может искать информацию о компании с такими критериями поиска, как размер компании, возможности трудоустройства, местоположение, отрасль, а также ее место в списке Fortune 500.

Здесь будет упомянута любая информация, которая удаленно связана с компанией, вам просто нужно зорко проверять всю информацию.

Объединение профессионалов со всего мира, чтобы сделать их более продуктивными и успешными — это девиз веб-сайта, и в целом они полностью выполняют свое обещание.

5.CrunchBase

База данных для экосистемы стартапов была основным намерением, когда CrunchBase был запущен в 2007 году. Последнее обновление будет заключаться в том, что в их базе данных содержится более 50000 компаний, и они гордятся точностью хранимых данных.

Широкая публика может предоставить данные, которые будут проверены модератором, прежде чем они будут обновлены на их серверах.

CrunchBase специализируется на технологических компаниях, стартапах, инвесторах, местах, ответственных лицах и мероприятиях.Они доступны на английском, китайском и японском языках.

Масштабируемый подход к сбору данных от сообщества участников с мощным машинным обучением; CrunchBase предоставляет точную и самую последнюю информацию о компаниях по всему миру.

С более чем 50000 активными участниками, CrunchBase была выбрана в топ-5 поисковых систем для информации о компании благодаря своим функциям, таким как доступ к информации, создание приложений и доступ к программируемому интерфейсу для приложений по доступной цене.

Заключение

Эти веб-сайты предоставят информацию, которую вы ищете. Итак, используйте эту информацию в своих интересах в интервью или в статье.

Оцените компанию на основе информации, и вы обязательно сделаете разумное вложение или решение о покупке. Эти веб-сайты определенно помогут вам найти информацию, которую вы ищете, возможно, бесплатно или по минимальной цене.

Как проверить надежность компании?


Бренд можно создать, используя множество методов.Вы не можете его вообще не строить. Каждый бизнес работает на свою репутацию, взаимодействуя с клиентами или партнерами. И именно их мнение обычно оказывается наиболее полезным при принятии решения о покупках или сотрудничестве. Большинство людей предпочитают пользоваться услугами, рекомендованными их другом, поэтому удовлетворение наших клиентов должно быть более ценным, чем любая рекламная кампания, освещение в СМИ или сильное положение на рынке.

Как помочь новым клиентам решить воспользоваться нашими услугами? Что, если мы еще не заработали репутацию надежного продавца и не все потенциальные клиенты достаточно решительно настроены, чтобы найти нас в Интернете (например,грамм. сайты сравнения цен)? Конечно, вы можете соблазнить их снижением цен, но в большинстве случаев покупатели предпочитают доплачивать и быть уверены, что их сделка пройдет гладко.

С другой стороны, как убедить потенциальных деловых партнеров в надежности и финансовой стабильности вашей компании? Есть ли способ подкрепить ваши аргументы?

Одно из возможных решений — получение сертификата, подтверждающего вашу надежность как продавца. Существует много разных типов для разных типов компаний, поэтому требования для получения такого сертификата могут отличаться.

Защита личных данных

Первый шаг — проверка вашего веб-сайта. Клиенты все больше узнают, какую информацию они оставляют в сети и как ее можно использовать. Одно предложение о том, что контент защищен с помощью SSL, — не решение — многие пользователи Интернета не знают, что это значит, в то время как другие сочтут это недостаточным. Вот почему гарантия того, что ваши посетители находятся в безопасности и не будут переданы другим лицам, завоюет их доверие. Сертификаты, подтверждающие безопасность сайта, выдаются e.грамм. ДОВЕРИЕ.

Однако, прежде чем искать подходящий сертификат в другом месте, обязательно создайте и опубликуйте свою собственную политику конфиденциальности.

Электронная коммерция

Один из самых популярных сервисов проверки бизнеса — Trusted Shops. Его веб-сайт позволяет клиентам проверять, как продавец был оценен, прежде чем получить свой значок — им необходимо предоставлять высококачественные услуги и информировать своих клиентов об условиях, платежах, возвратах и ​​т. Д.

Зная, насколько популярны такие программы, компания Google запустила программу Trusted Store.Поскольку компания не нуждается в представлении, наличие значка с логотипом, гарантирующего высокое качество обслуживания, является важной особенностью каждого веб-сайта электронного магазина.

Кредитоспособность

Во времена, когда многие электронные предприятия внезапно становятся банкротами, все больше и больше компаний хотят гарантировать своим клиентам финансовую надежность. Проверка третьей стороной или независимой организацией — убедительный аргумент для потенциальных партнеров.

Возможно, стоит зарегистрироваться в Национальном реестре долга.Помимо получения сертификата надежности, бизнес также будет внесен в их реестр. Любой, кто захочет найти компанию, получит информацию о ее финансовом положении или состоянии долга.

Сертификаты деловых партнеров

Программы проверки

часто предлагают компании, которые не специализируются в этой области, но в силу своего типа бизнеса они предлагают клиентам аналогичные услуги. Прекрасным примером этого могут быть процессоры онлайн-платежей.Чтобы начать сотрудничество с новым бизнесом, им необходимо провести процесс проверки, который, в зависимости от предлагаемых услуг, может быть длительным и подробным. Более того, новые компании проверяются также банками, которые работают с процессором платежей. У них есть доступ к различным базам данных и аналитическим материалам, которые они не раскрывают и не передают, но нет лучшего источника информации о надежности компании, чем банки.

Бейджи выдаются также крупными международными компаниями, такими как Authorize.net или PayPal, а также местные платежные системы, такие как PayLane.

Конечно, упомянутые (и не только) сертификаты — явный знак для потенциальных клиентов. Размещая соответствующий значок на нашем веб-сайте, мы повышаем надежность нашей компании — чем крупнее эмитент, тем более впечатляющим будет сертификат. Это также сводит к минимуму количество действий, которые должен предпринять потенциальный клиент. Поэтому меньше шагов, на которых они могут изменить свое мнение о покупках на нашем сайте, и вместо этого мы гарантируем им, что нажатие «купить сейчас» на 100% безопасно.

Понравилось то, что вы прочитали? Делиться!

Мистер Бэнкс

Мистер Бэнкс на самом деле вымышленный персонаж, но он действительно работает. Это делает его вымышленным сотрудником года PayLane 🙂



Как проверить безопасность веб-сайта с помощью 7 простых шагов

Это факт, что веб-сайты больше не используются только для развлечения, как это было в 2000-х.В настоящее время многие бизнесы ведутся через Интернет. Поэтому важно, чтобы знал основные безопасные платформы веб-сайтов , такие как WordPress.

Проблема в том, что динамизм технологических изменений приводит к быстрому изменению угроз — и, в некоторых случаях, маскировке перед лицом надежной конструкции, например.

В других случаях, независимо от того, насколько осторожны предприниматели, клиенты в конечном итоге остаются равнодушными и рискуют собой в ненадежной среде. .Это не всегда происходит из-за плохих намерений; иногда это происходит потому, что многие люди впервые взаимодействуют с цифровым миром.

Несмотря на это, есть много признаков того, что веб-сайт безопасен. Их знание важно, чтобы избежать потерь. Если вы хотите узнать больше о том, как проверить, безопасен ли веб-сайт, продолжайте читать эту статью. В нем мы рассмотрим:

Зачем компании нужен безопасный веб-сайт?

Каждый раз, когда вы заходите на веб-сайт и видите закрытый замок рядом с URL-адресом , это означает, что веб-сайт безопасен.Хотя некоторые люди думают, что это важно только для интернет-магазинов, потому что они требуют ввода личных данных и информации о кредитной карте, это не так.

С 2018 года безопасность веб-сайтов стала фактором ранжирования в поисковых системах, таких как Google. По этой причине, чтобы ваш веб-сайт с большей вероятностью появился среди первых результатов, он должен иметь сертификат безопасности.

Кроме того, безопасные веб-сайты внушают доверие вашей аудитории, повышая вероятность того, что они будут вести с вами бизнес.

Как узнать, безопасен ли веб-сайт?

1. Проверьте сертификат SSL

Проверьте URL-адрес своего веб-сайта и убедитесь, что в начале адреса написано «HTTPS» (вместо «HTTP»). Это означает, что веб-сайт защищен сертификатом SSL . Сертификат SSL используется для защиты всех данных, которые передаются из браузера на сервер веб-сайта.

Если вы прямо сейчас посмотрите на адресную строку своего браузера, вы увидите, что перед адресом нашего блога есть небольшой замок.

При нажатии на нее появится сообщение о том, что «соединение с этим сайтом безопасно», конечно, в зависимости от вашего браузера.

Хорошо, но что это значит? Что ж, это означает, что есть компания, гарантирующая, что общение между вами и компанией, ответственной за веб-сайт, не может быть перехвачено или изменено.

Представьте, что вы заходите на сайт покупок и сообщаете компании свои личные данные. Без SSL-сертификата эту информацию можно было бы скопировать — и ни вы, ни магазин не заметили бы взлома.

Таким образом, первый шаг к проверке безопасности веб-сайта — проверка наличия у него сертификата. Этот элемент безопасности уже учитывается Google при ранжировании сайтов в своем списке результатов поиска.

Итак, если вам интересно, как сделать так, чтобы ваш сайт WordPress отображался в Google, знайте, что наличие сертификата безопасности является одним из критериев.

2. Проанализировать, есть ли на сайте современная тема

Вам может быть интересно, какое отношение эта тема имеет к безопасности веб-сайта .Темы, а также практически все, что составляет веб-сайт, создается с помощью кода. Со временем некоторые настройки, написанные в коде, устаревают, что может сделать страницу уязвимой.

Согласно статье, опубликованной G1 в 2020 году, более миллиона сайтов WordPress могут быть уязвимы из-за некоторых плагинов и тем. Это не означает, что платформа хуже других, но, как и в случае с любой другой системой, владелец веб-сайта должен быть осторожен при выборе тем и плагинов.

Вы не можете просто рассматривать веб-дизайн; вам необходимо оценить безопасность, которую предлагает тема.По логике, использование пиратских тем — плохая идея. Несмотря на то, что они идентичны оригиналам, их использование равносильно тому, чтобы оставить дверь открытой для захватчиков — помимо того, что это преступное отношение к интеллектуальным правам разработчиков.

Итак, узнайте, как правильно добавить шаблон WordPress, прежде чем загружать какую-либо тему, хорошо?

3. Используйте инструменты безопасности для оценки сайта

Вероятно, на вашем компьютере установлен антивирус, не так ли? Большинство компаний, занимающихся цифровой безопасностью, разрабатывают системы, которые показывают пользователю, когда веб-сайт находится в безопасности.

В некоторых случаях эти инструменты не позволяют продолжить навигацию, если по адресу нет сертификата безопасности или когда срок его действия уже истек.

Другие компании позволяют пользователю Интернета оценить сайт и решить, продолжать ли его просмотр. Эти инструменты, как и плагины для браузера, обычно устанавливаются автоматически вместе с антивирусом. Более того, существует множество VPN-сервисов и функций тестирования на проникновение, которые могут быть вам полезны.

Прежде чем выбрать антивирус, проведет небольшое исследование репутации компании в Интернете.Есть очень интересный сайт под названием Virus Total. Вставляя URL-адрес в поле поиска для этого адреса, он выполняет анализ и приходит к выводу, представляет ли сайт риски для посетителей или нет.

Еще один инструмент, похожий на предыдущий, — это безопасный просмотр Google. Его преимущество в том, что он использует базу данных Google, которая генерирует анализ миллиардов страниц, увеличивая вероятность обнаружения вредоносных сайтов или попыток кражи информации с этих адресов.

4.Проверьте URL

Зная, что многие пользователи не обращают внимания на детали, некоторые преступники получают выгоду от такого поведения при применении мошенничества. Отсутствующая буква, опечатка и, в некоторых случаях, серьезные грамматические ошибки — явные признаки того, что сайт небезопасен и, скорее всего, это попытка мошенничества.

В некоторых случаях поддельные адреса заменяют символы, например, заменяя «o» на ноль. Для тех, кто спешит, сайт g0ogle.com может даже не привлекать внимания.

5. Остерегайтесь защитных пломб

Многие компании действительно сертифицируют сайты с помощью пломб безопасности. Однако создать фальшивый штамп в программах редактирования и вставить его на страницы несложно.

Идеальное действие — проверить подлинность печати , щелкнув по ней и проверив, перенаправляет ли она вас на веб-сайт компании, которая ее выпустила, или предлагает дополнительную информацию. Поддельные штампы — это изображения, на которых нет ни одной из этих деталей.

Вам также следует поискать значок в Google, чтобы проверить, действительно ли существует этот сертификат. Это важно на страницах электронной коммерции.

6. Узнайте, кому принадлежит сайт

Проверить эту информацию довольно просто. Каждый веб-сайт должен быть зарегистрирован на имя физического или юридического лица. Такие компании, как Whois Lookup, позволяют искать в поле Whois право собственности на веб-сайт.

7. Избегайте спама

Некоторые элементы — например, постоянно мигающие баннеры, преувеличенные обещания или очень низкие цены на продукты — являются классическими признаками того, что веб-сайт, электронная почта или реклама небезопасны.Хотя они выглядят как что-то из 1990-х и 2000-х годов, все еще есть люди, которые игнорируют функции и доверяют веб-сайтам, которые используют эти уловки.

Это факт, что технологические компании вкладывают средства в безопасность, и только пользователи должны вносить свой вклад в навигацию. Безопасный веб-сайт очень важен, но не менее важен и безопасный просмотр — и семь шагов, описанных в этой статье, помогут вам вести себя более осторожно в Интернете.

Теперь, когда вы знаете, как идентифицировать небезопасный веб-сайт и защитить себя от него, ознакомьтесь с нашим корпоративным руководством по WordPress, чтобы узнать, как создавать более безопасные веб-страницы на WordPress!

Руководство WordPress для корпоративных блогов

Получите бесплатный доступ прямо сейчас!

32 Сайта отзывов клиентов для сбора обзоров бизнеса и продуктов

Мы (и весь Интернет за последнее десятилетие) уже потратили некоторое время, чтобы убедить вас в важности получения отзывов клиентов в Интернете для вашего бизнеса.(Знаете ли вы, что в недавнем опросе HubSpot Research 1/3 респондентов заявили, что сайты с обзорами играют важную роль в их процессе принятия решений о покупке?)

Но если вы новичок в отзывах клиентов или не знаете, где их найти, давайте освежим некоторые основы и подчеркнем, почему они актуальны для вашего бизнеса.

Из-за нехватки времени? Используйте ссылки перехода ниже, чтобы перейти к нужному содержимому.

Содержание

Отзывы клиентов

Отзывы клиентов — это отзывы, предоставляемые бизнесу на основе опыта взаимодействия клиентов с организацией.Эти обзоры могут быть общедоступными или частными и собираются либо компанией, либо сторонними сайтами отзывов. Получая и анализируя отзывы клиентов, компании могут измерять степень их удовлетворенности и улучшать отношения с ними.

Преимущества отзывов клиентов

Есть две основные причины, по которым отзывы клиентов важны.

1. Отзывы клиентов — это возможность обучения для вашего бизнеса.

Отрицательные или нейтральные отзывы дают вашей компании возможность учиться и развиваться.Вы можете точно увидеть, где ваш бизнес не может удовлетворить потребности клиентов, и устранить распространенные препятствия на пути к покупке.

В случае особо плохих отзывов представители могут связаться с этими клиентами и предотвратить потенциальный отток. Они могут выделить конкретные болевые точки и выработать индивидуальные ответы на конкретные проблемы. Это заставляет вашу службу поддержки клиентов казаться более заинтересованной в достижении целей ваших клиентов, что приводит к меньшему количеству негативных отзывов и увеличению удержания клиентов.

2. Отзывы клиентов — это инструменты маркетинга и продаж для вашего бизнеса.

Другой важной причиной получения отзывов является возможность поделиться ими с потенциальными клиентами. Положительные отзывы могут использоваться в качестве отзывов клиентов во время привлечения потенциальных клиентов и могут помочь вам добавить больше контактов в вашу CRM. Фактически, 91% потребителей прочитали хотя бы один отзыв перед покупкой продукта. Так что не похлопывайте себя по спине в следующий раз, когда получите пятизвездочный отзыв; Убедитесь, что все знают, насколько хорошо работает ваша компания.

Источник

Имея это в виду, небезопасно предполагать, что мы все знаем, где искать эти положительные отзывы клиентов. Я имею в виду, что мы все могли бы выдать один или два сайта («Ага! И я думаю, вы можете заставить их появиться и в Google Maps?»), Но у нас точно нет подробного списка варианты в нашем распоряжении

Ознакомьтесь с нашим списком лучших веб-сайтов с обзорами продуктов для компаний B2B и B2C. Имейте в виду, что в каждой отрасли есть нишевые сайты.Например, работники ресторанной индустрии могут захотеть использовать UrbanSpoon или OpenTable. Это сообщение в блоге не попадет на сайты, относящиеся к одной отрасли, но на нем будут представлены сайты с обзорами, которые применимы к предприятиям практически любой отрасли.

Лучшие сайты для обзоров клиентов и продуктов

  1. Отзывы клиентов Amazon
  2. Список Энджи
  3. Выбор
  4. Trustpilot
  5. TestFreaks
  6. Какой?
  7. Отчеты потребителей
  8. Отдел по делам потребителей
  9. TripAdvisor
  10. Yelp
  11. Citysearch
  12. Google Мой бизнес
  13. Yahoo! Местные объявления
  14. Инфлюенстер
  15. Магазин приложений HubSpot
  16. Финансы Онлайн
  17. Сравнить Camp
  18. G2 Толпа
  19. TrustRadius
  20. GoodFirms
  21. Salesforce AppExchange
  22. Бюро лучшего бизнеса
  23. Стеклянная дверь
  24. Манта
  25. Capterra
  26. сотен X
  27. Facebook Рейтинги и обзоры
  28. Твиттер
  29. Foursquare
  30. Суперстраницы
  31. Десять лучших обзоров
  32. Ваш собственный сайт

Сайты отзывов клиентов для компаний B2C

1.Отзывы клиентов Amazon

Amazon был одним из первых интернет-магазинов, позволивших потребителям публиковать обзоры продуктов в 1995 году, и остается одним из наиболее важных ресурсов для потребителей, желающих принимать обоснованные решения о покупке. Даже если люди могут и покупают продукт в другом месте, если он продается на Amazon.com — если это не бензин или принадлежности для наркотиков, — то многие люди будут искать его обзор на Amazon, прежде чем решат купить.

Что будет отличать ваш продукт от продукта, который выглядит так же? Эти блестящие золотые звезды и хорошие отзывы покупателей.Продукты оцениваются по пятизвездочной рейтинговой шкале, которая разбита на процент отзывов на одну звезду, за которыми следуют наиболее полезные отзывы клиентов и самые последние отзывы клиентов.

Преимущества отзывов клиентов Amazon:

  • У Amazon более 300 миллионов пользователей, которые могут увидеть ваш отзыв.
  • Система рейтингов
  • Amazon проста и понятна.
  • Amazon предлагает функцию ранжирования продуктов, позволяющую оценить их популярность.
  • пользователя Amazon лояльны — 22% не будут смотреть на конкурентов, если обнаружат продукт на Amazon.
2. Список Энджи

Angie’s List, ориентированный на обслуживающий бизнес в США, представляет собой сайт с обзорами «более высокого уровня», поскольку пользователи фактически должны платить за членство. Но ты получаешь то, за что заплатил. Рецензии, представленные по шкале A – F, обычно очень хорошо продуманы — не много той разглагольствования и бреда, которые более распространены на бесплатных сайтах с обзорами. Отзывы не могут быть анонимными, что помогает сократить количество ложных или неверных отзывов, и компаниям также разрешено отвечать на опубликованные о них отзывы.

Создать страницу для вашей компании бесплатно. Получив свой, поощряйте своих клиентов, которые находятся в Списке Энджи, оставлять там отзывы — это могут делать только члены!

Преимущества списка Энджи:

  • Обзоры в Angie’s List обычно высокого качества, так как пользователи должны платить за использование сайта и не могут публиковать анонимные сообщения.
  • Несмотря на то, что это платная подписка, вы можете бесплатно добавить свою компанию в список Angie’s List.
  • Если у клиента плохой опыт работы с рекомендованным поставщиком, Angie’s List будет работать как с клиентом, так и с компанией, чтобы решить проблему.
3. Выбор

Есть клиенты, работающие в академических кругах? А еще лучше, они находятся в Австралии? Choice — это веб-сайт с обзорами, финансируемый участниками, расположенный в Австралии. Он независимо оценивает академические ресурсы, такие как библиотеки, и предоставляет своим членам подробные обзоры.

Основная часть его работы заключается в чтении академических статей, создании сравнений для каждого ресурса и написании руководств по покупке для клиентов. Кроме того, это позволяет участникам оценивать и обсуждать определенные ресурсы и библиотеки с другими участниками Choice.Если у вас есть клиенты из Австралии, мы рекомендуем поощрять тех, кто находится на CHOICE, оставлять там отзывы.

Преимущества выбора:

  • Choice публикует более 200 000 отзывов каждый год и обслуживает около 2400 учреждений по всему миру.
  • Поскольку Choice оценивает академические ресурсы независимо, его обзоры беспристрастны.
  • Choice предлагает функцию «Обзор дня», которая проверяет один академический ресурс в день. Вы можете прочитать его, даже если не являетесь участником Choice.
  • Choice имеет страницу «Выбор», где вы можете увидеть лучшие продукты, которые он рекомендует.
4. Trustpilot

Trustpilot — это быстрорастущая, управляемая сообществом платформа для обзора потребителей, базирующаяся в Дании, хотя она распространилась за пределы Европы в 65 стран, включая США. Платформа для бизнеса помогает компаниям со всего мира заблаговременно собирать отзывы клиентов. Это клиенты, которые пишут отзывы о продавце как , так и , проверяя их сторонними поставщиками.

Хотя есть бесплатная базовая версия (это позволяет вам создавать страницу профиля и собирать отзывы клиентов), платные версии позволяют создавать настраиваемые приглашения на обзор, делиться рейтингами и отзывами в социальных сетях и связывать данные обзора с вашими внутренними бизнес-системами. .

Преимущества Trustpilot:

  • Более 500 000 веб-сайтов имеют рейтинг Trustpilot.
  • Trustpilot использует собственную систему обзоров для оценки своего веб-сайта. На основании около 136 000 отзывов Trustpilot получил четыре звезды из пяти.
  • Trustpilot имеет расширенные функции SEO, которые помогают вашему сайту занимать более высокое место в поисковой выдаче, когда клиенты оставляют отзывы о вашей компании.
  • Trustpilot можно интегрировать с Shopify, Magento и MailChimp.
5. TestFreaks

Подобно TrustPilot, шведская компания TestFreaks помогает компаниям активно собирать отзывы клиентов и писать отзывы о продавцах, дополняющие их.

Еще одно классное дополнение? Его функция вопросов и ответов, которая позволяет потенциальным клиентам задавать вопросы и получать ответы непосредственно от вашей службы поддержки клиентов.

Преимущества TestFreaks:

  • TestFreaks получил 100 миллионов сканированных обзоров из более чем 15 000 источников.
  • TestFreaks предоставляет команду модераторов контента, которая анализирует контент на более чем 20 языках.
  • TestFreaks имеет функцию импорта, с помощью которой вы можете загружать отзывы внешних клиентов на свой веб-сайт.
6. Какой?

Какой? — это независимая организация по обзору потребителей, которая тестирует и анализирует продукты, а затем пишет о них.В отличие от «Списка Энджи», это люди из «Кого»? кто пишет отзывы — не заказчики. Они не принимают заявки на тестирование продуктов или включение опросов, но поощряют людей сообщать им о своих продуктах и ​​услугах по электронной почте [email protected]

Хотя это оставляет вам меньше возможностей влиять на то, попадут ли ваши продукты на их сайт, все же стоит знать об этом популярном сайте и проверять его, особенно если у вас есть клиенты в Великобритании. На сайте есть обзоры продуктов для всего, от посудомоечных машин и планшеты к машинам и кредитным картам.Он тестирует и рассматривает все эти продукты, а затем пишет о своих методологиях и результатах. Он также опрашивает клиентов на предмет лучших и худших фирм по обслуживанию клиентов.

Большая часть его контента бесплатна, но клиенты могут стать участниками за 10,75 фунтов стерлингов в месяц, чтобы получить доступ к списку «Лучшие покупки» и «Не покупайте», последним обзорам продуктов из его тестовых лабораторий и доступ к свою службу юридических консультаций для потребителей.

Какие преимущества ?:

  • Какой? предлагает более 8000 бесплатных обзоров.
  • Какой? тестирует и рассматривает более 3600 новых продуктов каждый год.
  • Чтобы доказать, что это беспристрастно, Что? предоставляет видео, демонстрирующее пользователям, как он тестирует и рассматривает каждый продукт.
  • Какой? на 100% независима. Он не принимает бесплатные товары от производителей и розничных продавцов, поэтому его отзывы остаются беспристрастными.
  • Какой? предлагает функцию «Предупреждение о безопасности», которая уведомляет пользователей, когда продукт считается небезопасным. Также есть функция «Уведомление о бренде», которая позволяет узнать, есть ли у бренда история создания небезопасных продуктов.
7. Потребительские отчеты

Некоммерческая организация Consumer Reports — это независимая организация по тестированию продуктов, которая проводит объективные тесты для оценки и рекомендации продуктов. Он проверил более 7,7 миллионов продуктов, не принимает рекламы и оплачивает все продукты, которые тестирует. (Интересный факт: компания покупает и тестирует 80 автомобилей каждый год!) Это примерно так же законно, как и получается. Таким образом, здесь мало что можно сделать, кроме как если вы продаете продукт, убедитесь, что он действительно хорош.

Источник изображения

По крайней мере, вы могли бы принять этот веб-сайт как урок по созданию отличного контента. Для каждого продукта, который он рассматривает, он предоставляет критерии обзора, обзоры продуктов, руководство по покупке и кнопки публикации в социальных сетях. Все это довольно исчерпывающе и, в общем, полезно. В значительной степени ключ к отличному контенту, верно?

Преимущества отчетов для потребителей:

  • Consumer Reports имеет более 63 испытательных центров, включая центр автомобильных испытаний площадью 327 акров.
  • Consumer Reports потратил более 30 миллионов долларов на тестирование и оценку продуктов.
  • В 2021 году компания планирует протестировать более 8 500 новых продуктов.
  • На выбор предлагается более восьми категорий продуктов, каждая из которых имеет несколько подкатегорий.
  • Consumer Reports предоставляет общую оценку для каждого продукта, поэтому вы точно знаете, как он сравнивается с другими продуктами в своей категории.
8.По делам потребителей

Consumer Affairs — это некоммерческая организация, которая рассматривает компании, используя «общий рейтинг удовлетворенности». Это среднее значение оценивается по шкале от 1 до 5 звезд, которая обновляется каждый раз при отправке нового обзора. На странице каждой компании представлен список всех его обзоры, которые включают в себя звездный рейтинг потребителя, а также краткое объяснение его оценки.

Consumer Affairs также позволяет пользователям отправлять записи обзоров, которые представляют собой двухминутные видеоролики, в которых люди рассказывают о своем опыте работы с брендом.Это делает обзор гораздо более убедительным, потому что вы действительно можете увидеть, как человек говорит и выражает свои искренние чувства по поводу компании.

Пособия по делам потребителей:

  • Отдел по работе с потребителями предлагает раздел «тенденции», где вы можете просмотреть самые последние и самые популярные обзоры.
  • Consumer Affairs предоставляет демонстрацию для брендов, желающих приобрести подписку на свои услуги.
  • Функция «Обзорная лента» позволяет вам исследовать все отзывы ваших клиентов в одной прокручиваемой ленте.
  • Отдел по делам потребителей имеет опцию «Видеообзор», где клиенты могут записывать свои отзывы.
9. TripAdvisor

Если вы работаете в сфере путешествий, отелей, авиакомпаний, развлечений или ресторанов, вам стоит ознакомиться с отзывами на популярном веб-сайте TripAdvisor. Как крупнейший туристический сайт в мире, он имеет более 225 миллионов отзывов, мнений и фотографий, сделанных путешественниками. В нем также есть потрясающий контент о низких ценах на авиабилеты, путеводители, списки аренды и форумы с советами практически для любого места в мире, которое вы только можете себе представить.Многие люди смотрят туда, прежде чем бронировать поездку.

Ключ к успешному профилю на TripAdvisor — сделать его как можно ближе к вершине индекса популярности, чтобы люди, ищущие информацию в определенном месте, видели ваше объявление. Согласно TripAdvisor, алгоритм рейтинга популярности основан на трех ключевых компонентах: количестве, качестве и давности отзывов. Вот выдержка из советов, которые они дают компаниям, стремящимся повысить свой рейтинг:

«Количество : попросите ваших гостей написать отзывы и воспользуйтесь инструментами нашего центра управления, чтобы напомнить им о выезде.Тем не менее, поощрение за обзоры противоречит правилам — ознакомьтесь с нашей политикой, чтобы убедиться, что вы понимаете, что можно, а что нет.

Качество : Гости, которым понравилось первоклассное гостеприимство и незабываемые впечатления, с большей вероятностью напишут положительные отзывы. Следите за тем, что написали предыдущие рецензенты, чтобы увидеть, что сработало, а что не сработало лучше всего для вашего объекта, чтобы вы могли поддерживать и улучшать свои услуги.

Recency : последние отзывы сильнее влияют на рейтинг вашей популярности, а более старые отзывы оказывают меньшее влияние на рейтинг отеля с течением времени.Еще раз рекомендуйте гостям писать отзывы, чтобы не пропустить свежую информацию ».

Преимущества TripAdvisor:

  • На сайте TripAdvisor собрано более 887 миллионов отзывов для восьми миллионов компаний.
  • TripAdvisor Plus дает вам доступ к скидкам на отели в более чем 100 000 местоположений.
  • Средний участник TripAdvisor Plus экономит около 350 долларов США при первом использовании членства.
  • На сайте TripAdvisor Business Advantage представлены лучшие отзывы о вашей компании, поэтому клиенты первыми видят их при просмотре вашего профиля.
10. Yelp

Yelp — это бесплатный сайт с обзорами, который позволяет потребителям оценивать компании по пятибалльной шкале. Любая компания может создать профиль на Yelp бесплатно, а пользователи могут создать свои собственные бесплатные профили для обзора компании. Вы также можете свободно отвечать рецензентам, но мы рекомендуем взвешенно и вежливо подходить к любым отрицательным отзывам, которые вы получаете, поскольку Yelpers находятся в довольно сплоченном сообществе.

Yelp также подвергся критике за последние несколько лет из-за некоторых слегка сомнительных методов, таких как стимулирование компаний к размещению у них рекламы в обмен на искажение результатов поиска для их бизнеса («Платите нам деньги, и мы опустим плохие отзывы!» ).Более опытные потребители научились смотреть на обзоры Yelp в целом и с учетом влияния рецензента, вместо того, чтобы быть отключенными от бизнеса из-за одного плохого списка.

Тем не менее, вам по-прежнему выгодно получать постоянный поток положительных онлайн-отзывов, поступающих в учетную запись Yelp вашего бизнеса, поэтому довольные клиенты всегда находятся в верхней части вашей ленты отзывов, особенно если вы ведете бизнес, основанный на местоположении. Информация профиля Yelp содержит такие вещи, как часы работы магазинов и информацию о местонахождении, поэтому ваш профиль часто появляется, когда люди ищут информацию о вашей компании в Google.

Преимущества Yelp:

  • Yelp имеет около 184 миллионов пользователей в месяц по всему миру.
  • Любой может подписаться на Yelp, и клиентам довольно легко оставить отзыв, что делает его хорошим источником отзывов клиентов.
  • Пользователи Yelp — это сплоченное сообщество. Активные пользователи предоставят много подробных отзывов о вашем бизнесе.
  • Исследования показывают, что повышение вашего рейтинга Yelp на одну звезду может увеличить доход на 5-9%.
11.Citysearch

Citysearch обладает всеми функциональными возможностями, как и другие сайты с обзорами в этой категории, но что делает его уникальным, так это его «лучшие из» победителей, которых вы можете искать в каждом городе. Например, если вы, как и я, любите картофель фри, вы можете выполнить поиск по запросу «лучший картофель фри в Бостоне», и Citysearch выдаст вам список ресторанов с отличным картофелем фри.

Источник изображения

Преимущества Citysearch:

  • Citysearch использует двухмодальную систему оценки «палец вверх» / «палец вниз».Он рассчитывается на основе процента пользователей / скаутов, порекомендовавших бизнес.
  • Cityseach имеет более 20 категорий для просмотра. Каждый показывает результаты, отфильтрованные по указанному вами местоположению.
  • Пользователи могут написать только один отзыв на каждую компанию. Это предотвращает ложные или недобросовестные отзывы и поддерживает точность оценок.
12. Google Мой бизнес

Вы знаете те отзывы, которые появляются при поиске компании в Google? Да, , те вещи, что в этом списке значительны.

Обновление алгоритма Google Pigeon использует параметры ранжирования расстояния и местоположения для улучшения результатов местного поиска. Итак, чтобы веб-сайт вашего бизнеса был должным образом оптимизирован для поиска, вам нужно создать проверенные учетные записи с локальными каталогами, особенно с каталогами Google, которые называются «Google Мой бизнес». Получение обзоров, комментариев, изображений и т. Д., Особенно в Google, может повысить ваш поиск. Только проверенные местные + страницы могут отвечать на отзывы.

Дополнительный бонус? Google Maps переносит эту информацию и эти отзывы в приложение, поэтому наличие большого количества контента сделает ваш бизнес более авторитетным.

Преимущества Google My Business:

  • Google — крупнейшая поисковая система в мире, контролирующая более 90% рынка поисковых систем.
  • Google может локализовать ваш поиск по обзору, то есть он будет показывать результаты только для предприятий, расположенных в той области, где вы искали.
  • Вы можете бесплатно создавать и настраивать свой бизнес-профиль в Google. Настройка занимает всего несколько минут.
  • Почти 10% поискового алгоритма Google основано на обзорах Google.Чем больше у вас положительных отзывов, тем выше будет рейтинг вашего бизнеса в поисковой выдаче.
13. Yahoo! Локальные работы

Подобно обзорам Google My Business, Yahoo! Местные обзоры позволяют пользователям публиковать обзоры компаний с пятизвездочной рейтинговой системой. Вот как могут выглядеть результаты:

По данным Statista, Yahoo! по-прежнему получает около 3% доли поисковых систем. Так что, хотя вы, возможно, не захотите тратить время на выяснение тонкостей алгоритма Yahoo!, получив несколько положительных отзывов на Yahoo! Localworks не может повредить этим 3%.

Преимущества Yahoo! Местные объявления:

  • Yahoo! Localworks интегрирует другие популярные сайты с обзорами в ваш бизнес-профиль. Таким образом, вы можете видеть все отзывы своих клиентов в одном месте, вместо того, чтобы входить в отдельные учетные записи.
  • Когда вы обновляете информацию о своей компании в Localworks, он обновляет профиль вашей компании на всех сайтах отзывов клиентов, которые вы связали с вашей учетной записью.
  • Yahoo! Localworks запускает уведомление каждый раз, когда покупатель оставляет отзыв, что позволяет быстрее реагировать на отрицательные отзывы.
14. Influenster

Если вы продаете потребительские товары, Influenster — это обзорный сайт, который вам нужно обязательно покрыть.

Influenster содержит отзывы покупателей и новости о потребительских товарах — в первую очередь, средствах для ухода за кожей, красоте, макияже, волосах и других товарах для здоровья и тела. Посетители могут искать на сайте по названию бренда или по конкретному продукту, который они ищут, а Influenster ссылается на веб-сайты, где посетители могут купить продукты.

Обзоры являются исчерпывающими и содержат много деталей и сопровождающих их изображений.Так что, если вы занимаетесь косметическим бизнесом, подумайте о том, чтобы посоветовать своим покупателям проверять ваши продукты на Influenster, чтобы привлечь новых клиентов.

Преимущества Influenster:

  • Более шести миллионов пользователей активно оставляют отзывы на Influenster.
  • Пользователи Influenster оставили на сайте более 50 миллионов органических отзывов.
  • Influenster отправляет своим пользователям «VoxBoxes», где они могут бесплатно опробовать новые продукты.
  • Influenster помогает предприятиям создавать «выборочные кампании», когда вы отправляете пользователям образец своего продукта, а затем продаете им полную версию.

Обзор веб-сайтов для компаний B2B

15. Магазин приложений HubSpot
Магазин приложений

HubSpot — это пространство, где компании могут просматривать расширения, инструменты и приложения, которые подключаются к их учетной записи HubSpot. Некоторые приложения созданы HubSpot, а другие разработаны партнерами и сторонними организациями.Предложение всех этих инструментов в одном месте упрощает пользователям HubSpot добавление новых функций в свои учетные записи, которые могут не входить в их подписку.

Хорошая особенность этого сайта отзывов клиентов заключается в том, что он разделен на категории в зависимости от продукта, который вы хотите установить. Есть отдельные разделы для инструментов маркетинга, продаж и обслуживания, а также другие разделы, такие как финансы, интеграция рабочих процессов, популярные приложения и многое другое.

отзывов оцениваются по пятибалльной шкале, и покупатели должны отвечать на такие вопросы, как: «Что вам понравилось в этом продукте? Что вам не понравилось в нем?» и «Какую проблему решил этот продукт?» Эти вопросы дают больше контекста для обзора, чтобы вы точно знали, почему клиент так оценил бизнес или продукт.

Преимущества торговой площадки приложений HubSpot:

  • В магазине приложений HubSpot представлено более 500 приложений.
  • Страницы продуктов содержат не только обзоры, но также информацию о ценах, примечательных функциях и требованиях к учетной записи для загрузки каждого инструмента.
  • Клиенты имеют возможность голосовать за отзывы, которые они считают полезными.
  • Обзоры на этом сайте содержат «оценки качества» таких функций, как простота использования, функциональность, стоимость покупки и поддержка клиентов.
16. FinancesOnline

FinancesOnline — одна из самых быстрорастущих платформ для обзоров программного обеспечения B2B и SaaS, которую ежемесячно посещают более 2 800 000 посетителей.

Он собирает тысячи отзывов пользователей каждый месяц, при этом каждый рецензент аутентифицируется через LinkedIn, чтобы гарантировать, что только реальные пользователи делились своим опытом с сообществом. Отзывы пользователей основаны на подробных опросах, которые предлагают действительно глубокий взгляд на каждый инструмент. Алгоритмический анализ также является основой для ежеквартальных отчетов по наиболее популярным категориям.

Чтобы сбалансировать точки зрения пользователей, каждый обзор также включает подробный анализ, подготовленный внутренней группой экспертов по программному обеспечению B2B, которые анализируют ключевые факторы удобства использования, такие как функции, интеграции, мобильная поддержка и т. Д. Эта оценка затем объединяется в уникальный SmartScore ™, позволяющая читателям легко понять, что сообщество экспертов думает о каждом бизнес-решении.

В качестве дополнительного бонуса страницы продуктов имеют высокий рейтинг в Google, поэтому получение нескольких положительных отзывов пользователей на их сайте может быть полезно для узнаваемости вашего бренда.

Финансовые преимущества Онлайн:

  • FinancesOnline ежемесячно посещает около трех миллионов посетителей и дает более десяти тысяч подробных обзоров компании.
  • Система SmartScore оценивает продукты по нескольким параметрам, включая функциональность, возможности совместной работы, индивидуальную настройку, простоту использования и многое другое.
  • FinancesOnline использует алгоритм удовлетворенности клиентов, который вычисляет общий балл для бизнеса на основе обзоров, комментариев и мнений, которые публикуются в различных каналах социальных сетей.
  • «Подтвержденный знак качества» позволяет пользователям узнать, что компания или продукт являются надежными и заслуживающими доверия.
17. Сравнить Camp

Compare Camp — это сайт обзора B2B, который в основном занимается программным обеспечением для бизнеса. Если вы хотите представить своей компании новый инструмент или систему, Compare Camp может помочь вам выбрать именно то программное обеспечение, которое подходит именно вам. Этот сайт не только показывает, как другие люди относятся к конкретному продукту, но также излагает ключевые преимущества продукта, а также любые новые тенденции, которые могут возникнуть в этой конкретной отрасли.

Когда вы впервые заходите на сайт, Compare Camp предоставляет вам список категорий программного обеспечения на выбор. После выбора раздела отображается описание категории с подробным списком продуктов и вариантов компании. Compare Camp также объясняет любые различные типы продуктов в этом разделе, а также основные функции, на которые следует обратить внимание при покупке этого программного обеспечения. Это очень удобное руководство, особенно если вы рассматриваете продукт, который раньше не покупали.

Преимущества лагеря сравнения:

  • Более 100 000 компаний используют Compare Camp каждый месяц.
  • На выбор предлагается более 25 категорий продуктов, включая программное обеспечение CRM, программное обеспечение для продаж, программное обеспечение для электронной коммерции и многое другое.
  • В каждой категории представлен список «10 лучших» программного обеспечения, доступного в этом разделе.
  • Если вы не знакомы с продуктом, каждая категория содержит краткое описание того, что это за программное обеспечение и почему оно может вам понадобиться.
18.G2 Толпа

Если ваша компания продает программное обеспечение, вы должны быть уверены, что присутствуете на G2 Crowd. Каждый месяц более 5 миллионов человек, желающих купить программное обеспечение, читают более миллиона отзывов пользователей на этом веб-сайте, чтобы принимать более обоснованные решения о покупке.

G2 Crowd работает как Yelp, но в определенной нише. Компании оцениваются по пятизвездочной шкале, и обзоры охватывают все, от настройки и простоты использования до безопасности и поддержки. Рецензенты отвечают на вопросы типа «Что вам больше всего нравится?»; «Что тебе не нравится?»‘; и «Рекомендации другим лицам, рассматривающим продукт.»Кроме того, вы можете голосовать за и против других отзывов.

Преимущества G2 Crowd:

  • На G2 Crowd размещено около 1,4 миллиона отзывов.
  • G2 Crowd предлагает вариант видеообзора, в котором пользователи могут записывать себя, оставляя отзыв.
  • Когда покупатель оставляет отзыв, вы можете увидеть, является ли он проверенным пользователем и насколько он активен на платформе.
  • G2 Crowd позволяет компаниям запрашивать отзывы клиентов.Это поможет вам создать пул отзывов клиентов для вашей компании.
19. TrustRadius

Как и G2 Crowd, TrustRadius — это сайт онлайн-обзоров для компаний, производящих программное обеспечение. Рецензенты на сайте проходят аутентификацию через LinkedIn, чтобы убедиться, что они являются пользователями (хотя сами отзывы могут быть анонимными), что позволяет пользователям видеть, что их соединения LinkedIn говорят об определенных частях программного обеспечения на TrustRadius. Это добавляет уровень доверия тем, кто читает этот сайт.

Вы можете использовать сайт для просмотра обзоров отдельных компаний или сравнения двух компаний бок о бок, чтобы сравнить их пятизвездочные рейтинги, скриншоты их продуктов, сведения о ценах и комментарии пользователей от рецензентов.

В дополнение к обзорам компаний TrustRadius собрал целую кучу руководств для покупателей по категориям, включая программное обеспечение для управления талантами, программное обеспечение для бизнес-аналитики, основное программное обеспечение для управления персоналом, социальные сети и A / B-тестирование, чтобы помочь людям найти для них правильный продукт. на основе сотен отзывов и оценок пользователей.

Преимущества TrustRadius:

  • На TrustRadius размещено более 300 000 отзывов клиентов.
  • TrustRadius не продает потенциальных клиентов или размещение рекламы. Это делает обзоры беспристрастными, и поставщики не могут исказить результаты.
  • TrustRadius обзоры более подробны. В среднем в каждом обзоре более 400 слов.
  • Каждый отзыв клиента проверяется исследовательской группой TrustRadius и оценивается на предмет качества, глубины и детализации.
20. GoodFirms

GoodFirms — это платформа для исследований и обзоров B2B, которая фокусируется на соединении соискателей услуг с подходящими поставщиками программного обеспечения и услуг.

Источник изображения

GoodFirms анализирует наиболее эффективные компании и программные решения по трем важным критериям: качество, надежность и возможности. Эти показатели далее сегментируются на достоверные отзывы клиентов, портфолио компании, ее проникновение на рынок, многолетний опыт и удобство обслуживания.Затем компании ранжируются на основе их совокупных результатов исследований. GoodFirms предлагает быстрые фильтры для сортировки поставщиков услуг по их почасовой ставке, местоположению и количеству сотрудников.

Преимущества GoodFirms:

  • GoodFirms имеет более 30 000 отзывов клиентов и 60 000 бизнес-профилей на своем веб-сайте.
  • GoodFirms предлагает платформу для обсуждения, где клиенты могут сформировать онлайн-сообщество и обсудить конкретные продукты и бренды.
  • GoodFirms предоставляет более тысячи уникальных примеров из практики, в которых описываются новые тенденции и технологии, появляющиеся в вашей отрасли.
  • При поиске конкретной компании или продукта отзывы клиентов могут быть отфильтрованы по устройству, местоположению и отрасли.
21. Salesforce AppExchange

У вас есть приложение на Salesforce AppExchange? Тогда вы захотите отслеживать там рейтинги и отзывы вашего приложения.

отзывов основаны на пятизвездочной рейтинговой системе, и в каждом приложении перечислены обзоры, в которых сначала указаны наиболее полезные положительные отзывы и наиболее полезные отрицательные отзывы, а затем все отзывы, из которых пользователи могут фильтровать по рейтингу, дате и полезности.Этот сайт отзывов клиентов отличается прозрачностью, позволяя пользователям получать доступ к тысячам обзоров и видеть количество загрузок всего за несколько кликов.

Преимущества Salesforce AppExchange:

  • В Salesforce AppExchange указано более пяти тысяч продуктов.
  • На этом сайте есть опция живого чата, где вы можете поговорить с кем-нибудь, если у вас есть вопросы о компании, продукте или обзоре.
  • Пользователи Salesforce AppExchange могут оставлять комментарии, лайки и сообщения о других отзывах клиентов.

Сайты отзывов клиентов для компаний B2B и B2C

22. Бюро лучшего бизнеса

Некоммерческий сайт Better Business Bureau (BBB) ​​оценивает все типы предприятий по набору передовых методов обращения с общественностью. Он напрямую не рекомендует и не поддерживает какие-либо предприятия, продукты или услуги; он просто предоставляет общественности информацию о компаниях и о том, соответствуют ли они стандартам аккредитации BBB.Он также будет рассматривать как аккредитованные, так и неаккредитованные предприятия.

Список бизнес-профиля на BBB содержит общую обзорную информацию, такую ​​как краткая биография компании и статус аккредитации компании, история любых жалоб, поданных в отношении бизнеса, и сведения о том, были ли они разрешены, отзывы клиентов и рейтинг BBB A — F бизнеса.

Преимущества Better Business Bureau:

  • В Better Business Bureau указано более 5,4 миллиона бизнес-профилей.
  • Как организация, спонсируемая государством, вы можете быть уверены, что ее обзоры беспристрастны.
  • Получение аккредитации BBB показывает, что ваш бизнес является надежным и заслуживающим доверия.
  • В прошлом году в США обзоры BBB были просмотрены более 120 миллионов раз.
  • 85% потребителей предпочитают вести бизнес с компанией, аккредитованной BBB.
23. Стеклянная дверь

Glassdoor — это сайт отзывов сотрудников, который помогает любому — от потенциальных сотрудников до потенциальных клиентов и инвесторов — получить представление о том, что такое на самом деле изнутри.Другими словами, это помогает измерить более качественные факторы, такие как оценка.

Сотрудники могут рассказать, каково это проходить собеседование и работать в своих компаниях, а сайт показывает посетителям, какие компании получают самые высокие оценки их сотрудников. Многие работодатели используют его для создания своего бренда занятости, чтобы они могли нацеливать и набирать кандидатов, но вы также можете использовать отзывы, чтобы делиться идеями для улучшения среди своей управленческой команды внутри компании.

Создание учетной записи работодателя — это бесплатно, и его легко отслеживать и отвечать на отзывы.Например, вы можете настроить оповещения, чтобы вы получали электронное письмо каждый раз, когда публикуется новый отзыв, чтобы вы могли подтвердить и ответить на каждый из них.

Преимущества Glassdoor:

  • На Glassdoor перечислено около 90 миллионов отзывов, зарплат и идей.
  • Более 60 миллионов человек ежемесячно используют Glassdoor для поиска информации о компании или провайдере.
  • Отзывы оставляют сотрудники, имеющие опыт работы с этой компанией.
  • Когда компания отвечает на отзыв, он показывает вам имя сотрудника, а также его должность.
24. Манта

Manta — это сайт отзывов клиентов, предназначенный в первую очередь для предприятий малого и среднего бизнеса. Вместо того, чтобы сразу отображать лучшие отзывы клиентов, Manta организует результаты поиска на основе релевантности вашего ключевого слова. Затем он отображает список компаний с их контактной информацией, чтобы пользователи могли быстро связаться с компанией.

Manta отличается от большинства сайтов с обзорами, потому что он больше ориентирован на объединение людей, чем на обзоры продуктов и услуг.Чтобы найти отзывы клиентов, вам нужно выбрать компанию, перейти на страницу с их отдельным списком и прокрутить список их функций и продуктов, прежде чем увидеть отзыв. Таким образом, клиенты используют отзывы как один из последних аргументов в пользу покупки продукта или услуги.

На Manta цель состоит в том, чтобы ранжировать ваш бизнес как можно выше по каждому релевантному ключевому слову, по которому пользователи могут выполнять поиск. Пока ваша компания находится в топе результатов поиска, у вас будет больше шансов найти потенциальных клиентов, использующих этот сайт.

Преимущества Manta:

  • Manta располагает данными о 35 миллионах предприятий в 149 странах.
  • Каждый месяц Manta добавляет на свой веб-сайт 14 000 новых объявлений.
  • На Manta легко оставлять отзывы. Вы просто заполняете звездный рейтинг и пишете краткое описание, обосновывающее вашу оценку.
25. Capterra

Если вы занимаетесь SaaS, Capterra — это обзорный сайт, на котором оценивается программное обеспечение, продаваемое компаниями B2C и B2B.Он имеет простую в использовании внутреннюю поисковую систему, которая позволяет пользователям искать программное обеспечение по отрасли, компании или типу программного обеспечения. После завершения поиска Capterra отображает список компаний, релевантных вашему ключевому слову, и краткое описание их продуктов.

Пользователи также могут сравнивать товары на сайте. Capterra имеет функцию «сравнить с», которая позволяет выбрать до четырех компаний и одновременно отображает преимущества каждой из них. Вы можете увидеть все, от простоты использования до качества их поддержки клиентов, — все в одном всеобъемлющем обзоре.Это позволяет пользователям легко и эффективно находить программное обеспечение, которое наилучшим образом соответствует их потребностям.

Преимущества Capterra:

  • На Capterra размещено более 1,5 миллиона проверенных отзывов клиентов.
  • Capterra предлагает 800 категорий на выбор, а также обзоры более чем 50 тысяч товаров.
  • Прежде чем перейти к обзору, Capterra дает краткий обзор компании, ее продуктов и ее миссии.
  • Capterra предоставляет список плюсов и минусов для каждого бизнес-профиля.Это дает пользователям снимок лучших и худших функций для каждой компании.
26. Сот

HundredX — это сайт для обзоров и инструмент для обслуживания клиентов. Компании создают учетную запись на веб-сайте и просят клиентов оставлять отзывы после работы с ними. HundredX оптимизирует процесс, предоставляя инструменты, которые автоматически рассылают опросы и собирают отзывы от имени компании. С помощью этого сайта командам обслуживания клиентов не нужно вручную искать отзывы или сканировать сторонние сайты, чтобы получить отзывы клиентов.

Преимущество подписки на HundredX в том, что отзывы являются частными. Если вы получили плохой отзыв, лиды не увидят эту обратную связь, и на них повлияют негативные комментарии. Это дает вашей компании шанс исправить свою ошибку, прежде чем терять потенциальных клиентов.

Преимущества HundredX:

  • HundredX предоставляет профили для более чем 1600 предприятий из более чем 60 уникальных отраслей.
  • HundredX предлагает пользователям стимулы оставлять отзывы.Примерно 90% его пользователей участвуют на регулярной основе.
  • Инструменты HundredX помогут вам создать автоматизированную систему для создания опросов и сбора отзывов клиентов. Это обеспечивает постоянный поток отзывов по мере того, как вы продолжаете расширять свою клиентскую базу.

Другие места для потребительских отзывов

Онлайн-обзоры также существуют на сайтах, которые не обязательно созданы только для публикации онлайн-обзоров. Некоторые компании используют свое присутствие в социальных сетях и веб-сайты для поощрения онлайн-обзоров…. а некоторые бренды просто получают их по собственной инициативе, к лучшему или к худшему.

Вот несколько сайтов, которые, если вы решите (пожалуйста, выберите), могут служить дополнительными центрами для онлайн-обзоров. И они потрясающие, потому что у них огромный охват, и у вас есть некоторый — если не полный — контроль над этими свойствами.

27. Facebook Рейтинги и обзоры

Знаете ли вы, что на Facebook есть место, где фанаты могут оставлять оценки и отзывы о вашем бизнесе? Конечно, есть … он точно назван «Рейтинги и обзоры Facebook».Он отображается в левой части вашей страницы Facebook, и вы не можете перемещать или удалять его, как другие части своей страницы.

Источник изображения

Любой, кто вошел в Facebook, может опубликовать рейтинг или обзор компании. Все, что им нужно сделать, это перейти в раздел отзывов на вашей странице, щелкнуть серые звездочки, чтобы выбрать рейтинг, а затем написать дополнительный отзыв. Они могут сделать этот отзыв общедоступным, видимым для друзей или только им.

Преимущества рейтингов и обзоров Facebook:

  • Их больше 2.7 миллиардов пользователей, которые активны на Facebook каждый месяц.
  • Чтобы собирать отзывы на Facebook, все, что вам нужно сделать, это создать бизнес-профиль Facebook.
  • 2/3 пользователей Facebook посещают профиль местного предприятия в Facebook не реже одного раза в неделю.
  • Facebook — это платформа, предназначенная для общения. Это увеличивает шансы на продуктивное общение с теми, кто оставит отзыв о вашей компании.
28. Twitter

Из-за смехотворно динамичной природы Twitter кажется странным местом, где можно собирать отзывы.Но хотя пользователи не всегда могут искать отзывы непосредственно в Твиттере (если, возможно, вы не запустили какой-либо хэштег для обзора), твиты по-прежнему индексируются в результатах поиска. Это означает, что твит пользователя, будь то бесплатный или менее интересный, может появиться в поисковой выдаче, когда кто-то ищет отзывы о вашем бизнесе.

Не только это — можно активно делать с положительными твитами, которые приходят в ваш адрес. Например, мы протестировали элемент социального доказательства конверсий здесь, в HubSpot, приложив три твита, которые дали положительные отзывы о электронной книге, которую мы продвигали в то время.Угадай, что случилось? CTA с тремя твитами преобразован лучше, чем CTA без твитов. Если вы начнете добавлять в избранное твиты, которые могут служить положительными отзывами в будущем, их будет легче найти, когда вы захотите использовать их в своем маркетинге.

Преимущества Twitter:

  • Твиттер ежедневно посещает более 186 миллионов активных пользователей.
  • Twitter позволяет вам общаться с пользователями как публично, так и конфиденциально. Это означает, что вы можете отвечать клиентам в своей ленте, а также при необходимости переводить беседу в режим прямого обмена сообщениями.
  • Обратная связь в Твиттере сразу же. Когда клиенты хотят высказать свое мнение о вашем бизнесе, они могут сделать это практически мгновенно в Twitter.
  • Отзывы в Твиттере качественные. Вам не нужно беспокоиться об общей оценке или оценке удовлетворенности, когда клиенты оставляют отзывы.
29. Foursquare

Да, люди все еще используют Foursquare. Фактически, тонна людей все еще использует его: в январе Foursquare набирал 55 миллионов активных пользователей в месяц (MAU).

С помощью приложения вы можете не только регистрироваться в разных местах и ​​на разных предприятиях, но и оставлять отзывы на Foursquare, что делает его еще одной интересной платформой, на которой потенциальные клиенты, ищущие предложения, могут найти ваш бренд или бизнес, а также пятизвездочные обзоры. .

Если ваш бизнес зависит от пешеходной доступности — рестораны, кафе, торговые бутики и т. Д. — убедитесь, что ваш бизнес-профиль Foursquare заполнен и обновлен, чтобы люди могли найти вас, когда они пойдут на регистрацию, — а затем спросите ваши посетители оставляют отзывы о вас там.

Преимущества Foursquare:

  • На Foursquare ежемесячно более 55 миллионов активных пользователей.
  • Более двух миллионов предприятий используют Foursquare для связи с клиентами.
  • Foursquare предоставляет маркетинговые инструменты для вашего бизнеса. Вы можете проводить специальные акции и скидки для существующих клиентов, а также давать советы новым пользователям, которые впервые посещают ваш бизнес.
30.Суперстраницы

Superpages позволяет искать компании на основе их удаленности от вас, общего рейтинга, подкатегории отрасли, онлайн-видео и даже рекламных купонов.

После того, как вы найдете компанию, которая вам нравится, этот сайт покажет вам, где она находится на карте, а также краткое изложение обзора, в котором перечислены все отзывы, оставленные для организации. Посетители могут быстро оценить, что другие пользователи говорят о бизнесе, и использовать купонные ссылки, чтобы получить те же предложения, что и другие клиенты.

Источник изображения

Преимущества Superpages:

  • Клиенты в основном используют функции карты / местоположения для поиска предприятий. Это идеально подходит для малых и средних предприятий, многие из которых расположены только в нескольких районах.
  • В профиле каждой компании есть вкладка «Просмотр услуг», которая точно объясняет, что организация может предложить.
  • Superpages предоставляет услугу, которая бесплатно оценивает репутацию вашего бренда в Интернете.
  • Superpages ориентированы на участие местного населения. Таким образом, вы можете быть уверены, что отзывы о вашем бизнесе исходят от клиентов из вашего региона.
31. Десять лучших обзоров

Трудно устоять перед хорошей топ-10. Top Ten Reviews удовлетворяет это желание, предоставляя посетителям список из 10 подробных обзоров для каждого сообщения на сайте. Эти посты также имеют широкий спектр тем, затрагивая все, от матрасов до ландшафтного дизайна и ноутбуков.

Источник изображения

Также есть панель «трендов», которая показывает категории, популярные в настоящее время на сайте. Как владелец бизнеса, это может дать вам представление о том, что потребители покупают больше в данный момент.

Преимущества первой десятки обзоров:

  • Top Ten Reviews содержит обзоры продукции, начиная от газонокосилок и заканчивая очками.
  • В каждом обзоре есть раздел «наш вердикт», в котором суммируются плюсы и минусы каждого продукта, а также рекомендуется ли его рекомендовать веб-сайт.
  • Для каждого продукта Top Ten Reviews предоставляет последние доступные предложения и связывает пользователей с тем, где они могут их найти.
  • Десять лучших обзоров очень подробны. В них есть разделы, в которых описываются функции продукта, его характеристики, общая производительность, отзывы пользователей и многое другое.
32. Ваш собственный веб-сайт

Наконец, единственное место, где у вас есть полный контроль: ваш веб-сайт. Это отличное место для публикации отзывов, которые вы получаете (возможно, вставьте некоторые из тех твитов, которые вы добавили в избранное?).

Вы можете выделить на своем веб-сайте раздел, посвященный только обзорам и характеристикам, и даже включить форму, чтобы счастливые клиенты могли отправлять свои нежелательные отзывы.

Но если вы активно проводите кампанию за положительные отзывы в Интернете и сталкиваетесь с довольными клиентами, которые хотят оставить вам положительный отзыв, но не имеют учетных записей на таких сайтах, как Yelp, Angie’s List или Google, удобно иметь место на вашем сайте. сайт, чтобы опубликовать свои добрые слова. Также подумайте о добавлении отзывов на целевые страницы и страницы продуктов.

Преимущества вашего собственного сайта:

  • У вас есть полный контроль над форматом и рейтинговой системой ваших отзывов.
  • Вы можете указать, какие обзоры вы хотите публиковать на своем веб-сайте.
  • Наличие отзывов на вашем сайте является своевременным. Люди, просматривающие ваш сайт, могут читать ваши положительные отзывы, когда покупают ваши товары.

Какой сайт отзывов клиентов лучше?

Простой ответ — все они. Правильный ответ немного более субъективен.

Лучшим сайтом отзывов клиентов для вашего бизнеса будет тот, который используют ваши клиенты чаще всего. Чем больше отзывов вы получите, тем больше вы узнаете о своем бизнесе и о том, что клиенты думают о вас.

Выберите несколько из списка выше и начните собирать отзывы, которые помогут улучшить и расширить свой бизнес.

.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *